SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01920T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01920T0
Domain Number 1 Region: 79-136,178-213
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000144
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  AMSG_01920T0
Domain Number - Region: 231-271
Classification Level Classification E-value
Superfamily PH domain-like 0.0689
Family Phosphotyrosine-binding domain (PTB) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_01920T0
Sequence length 438
Comment | AMSG_01920 | Thecamonas trahens ATCC 50062 hypothetical protein (439 aa)
Sequence
MADKLGLTRAGARLFDIFPSIGGYDRKPRSHITQQGEHLESAKKHEASLVLHTVQRFDKY
ESHMLAAKHKHAIKHSRLARHAYLHYMPIRSDEEAIRLSALALQAAFGSFDPHVHRIGFL
NRTHILTDYVPAFLVVDAVETSASAAATVLNIPHAGAARSPKSKPGAADTPLTRRSADEW
ERLILAQLQLEPPRSTGLATLAFLTTIRRSEYYGAMYFMPSKVETSLHGLLPHRIMICIS
PSRIYFVDHTSRTRIAKYHFKELRHWGGEHSHTKWLVTILKAEEARLLRSGSHAILGNAR
LIPRQPSSPDEPEPAVSDETYVFHTPQGLFISTALFKAIHEHIRDQHMRTASRRSGPPVR
RHQAPPTLANPLYSPSADVQAFATTASPDSTAARNPVDTAGRRRHHHAGLGFGPRPLLLA
RLVVFGLHLLVLLGHRLL
Download sequence
Identical sequences A0A0L0DUC6
XP_013761421.1.50528 AMSG_01920T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]