SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01933T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01933T0
Domain Number 1 Region: 607-660,695-758,842-1101
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-91
Family Ras GEF 0.0000251
Further Details:      
 
Domain Number 2 Region: 1125-1205
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.03e-16
Family cAMP-binding domain 0.0039
Further Details:      
 
Domain Number 3 Region: 125-235
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000179
Family Second domain of FERM 0.00095
Further Details:      
 
Weak hits

Sequence:  AMSG_01933T0
Domain Number - Region: 14-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000362
Family Ubiquitin-related 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_01933T0
Sequence length 1268
Comment | AMSG_01933 | Thecamonas trahens ATCC 50062 cell division control protein (1269 aa)
Sequence
MDGSGPLSRISGAHHVVKVHFPDHSRELTLRADEATTVAAVLEMAGDKMGMPTDVVSNYF
SIWLVAPSTAEDSPRLELFLPQALRISPLATAWKGLVHHYRGLGMADAGAFLELRKSPRL
TLDEELAIEHPIALNMLYCEALDNIRNSTFAVSSKDAIALAGMVFHIELGAFSGETHIKG
YYTRRLIEVLPTQICESSKFNVDKFESKVLAAHASHGRSSRLLTKLQFLERVRELASPIY
GAQLFVCDVAVNDGFTKGLKTGDTSIVAVSADSLAFLAGPLHAHKVVASFPLGLSSESDE
SVSVAVTSEDTGLVLTFTSVKVGKKGQTTSSLAVSSKEAYLLARRLPRELVTSVPNSMYA
VTATPTGEVESLEELICDLEFIPAAADAEPSEVCVSVATSTSPSLSPPVDSPAPPAPPAP
PTPQTLTATGSGSGSGSGTGERAKSAGKGKSEISSDSVSDSGSGSGSGSGSGSGSGSDSS
SSGSSSDSGVADGSGGAAGSASLASVAMLKVRSSRKKRRVESANADLRDMLKEKATAMRE
RRVRESAAVTIQQAWRGYLSRQRLGVLGGIVRRVLDSLARARDRVPAFICYNPREDLLSS
AYVRAKILAMDKILLLNRITSPSVRDPELTRAILYTYPNYMSDAGFLNYLKLRFGSNPGP
ARDELLDLLEATAPELAVSPQTRAALHDDATTRLYPFHSATRDALQNRVLEVMELWFKQH
PRLLAKESRLRSEVYEVLTAMSGSEFVILEDVVDPLAVVAEEAGEAGTASDGDVTRGSCV
RTHTTPVSIEVGARARRLTTALQLKYGGIGVNEDEGGEEGAARRGRSGSLATLASGENEV
EMPTSILPLDSTISNVMQLSPVEIARQITLMDYDALQQIEPREFLKQRWAKKNASLVAPN
LITMIERFNSVVGWAASEVLSVATFEGRAAVICRLLDVASAARALNNFSALMAIVSALES
AGISRLGFTWDVVPAAYVEKLADLKLTMSMASNYSKYRAALKAAEAPCVPYLGVLLQDLT
FIDDGNEDFVDGKLLNVDKQAMTAKVIDMIVSFQGGRYALQPVLIIEQYLANAKQLSEKE
QYAASLELEPRELKNSRKMGHKKIAYVDETVTQERLADMTAAVEVPQRFISDMLQHLRER
TFSARELIIKKGDEGHSMFFIVRGVAEVELPNGVKIPLNQGQFFGEMALFANLKRGPTCL
TREMCAEMLATEPQLDAQFRAVVEARQEMNEAISSDTKKGKKKGKKGRREPATPKWMQQL
AASASGRP
Download sequence
Identical sequences A0A0L0DTZ1
AMSG_01933T0 XP_013761431.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]