SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03006T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03006T0
Domain Number 1 Region: 237-302
Classification Level Classification E-value
Superfamily HMG-box 0.000000576
Family HMG-box 0.0035
Further Details:      
 
Domain Number 2 Region: 39-110
Classification Level Classification E-value
Superfamily HMG-box 0.0000301
Family HMG-box 0.0077
Further Details:      
 
Weak hits

Sequence:  AMSG_03006T0
Domain Number - Region: 318-388
Classification Level Classification E-value
Superfamily HMG-box 0.00432
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_03006T0
Sequence length 472
Comment | AMSG_03006 | Thecamonas trahens ATCC 50062 hypothetical protein (473 aa)
Sequence
MESVPVLASVPLLPSARRVVRNMHKAKHGRPMAGKALADANKVTAARNVNIIFSTHEGAK
AEYADMAHTDKVTRIKARYAALSPGERAQFMAHAAAVLEAFIDKFPYYAPGALEKAAIDG
PGVDGDLFPPVLAAAITRGTGRTRKTRAAIRRPKRAKPAAELFARHLYPELASLNVTTPE
YRSKLAEGKERFESLPAMDREPFEAEHARLAAIELVQLEAFFRLHPGQRTTADPFKPKRP
PRPDHLATVDYAKEHAMSYKEARKVAWTNTSDEDKAKYIARAKEEEKAYAAKLATYKVRF
PHNAYIHADAIPAGIALPRSARSIYFDNNRERAARAVLADTEPGAPLDLVAVFDRLNADW
ESLHSSERADHETRAAAERADYDALVKKELSKKDAARAQKRAKAKAAKAAQQSASSKASA
EIAPRSAHSRAAKTAAAEAVAADAKASAEAADATDDDDDNDDDDDDDSESSA
Download sequence
Identical sequences A0A0L0D326
XP_013760348.1.50528 AMSG_03006T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]