SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03021T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03021T0
Domain Number 1 Region: 1839-2327
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-89
Family Calponin-homology domain, CH-domain 0.0000000284
Further Details:      
 
Domain Number 2 Region: 224-340
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-23
Family Second domain of FERM 0.00029
Further Details:      
 
Domain Number 3 Region: 360-438
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000262
Family Third domain of FERM 0.00097
Further Details:      
 
Domain Number 4 Region: 1410-1447
Classification Level Classification E-value
Superfamily WW domain 0.000000237
Family WW domain 0.0037
Further Details:      
 
Weak hits

Sequence:  AMSG_03021T0
Domain Number - Region: 108-164
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00022
Family First domain of FERM 0.087
Further Details:      
 
Domain Number - Region: 1683-1752
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00602
Family Rad50 coiled-coil Zn hook 0.013
Further Details:      
 
Domain Number - Region: 39-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0274
Family Ubiquitin-related 0.063
Further Details:      
 
Domain Number - Region: 1726-1821
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_03021T0
Sequence length 2338
Comment | AMSG_03021 | Thecamonas trahens ATCC 50062 fimbrin (2339 aa)
Sequence
MAALEGMNKSLFAEVDPAQAGGQEVTVKVTLQKYERGKLDERTKSMRFNNAMYVDDVCKQ
VAEAFRMDDSPQFALWNDGGGVLEDSYFLKREQTLRFYDIVNLDELTYKSKMRPLRVELM
DGSIKTVMIDMSAPTKDLVALVCEKNGIANPAEFAFQVSLTEEQKEAEAKRQKEVAKIRA
KAGLDTSFSGTKIVSKKGIDEDWLSADQTLAQCGVLPEYSVLLKKKFFFSDASVDTSDPL
TLSLLFNQYQDDVANGNLPVARDEAILLAALSAQVTLGDHAPGKHTVKKIDFGQWLPEEY
RKEGKKTFKEVLAAHAKIRGTKADAAKFRFVQLIRSLETFGISTYHVQEPIRSKKTNKLT
KKFQPVILGVSKSHLYRFDPIEKKSLSKPFALTQLRRWAPSDTSLTLDFGDHDQEYYTVL
TEEGRAIAALISGYIDLILSQRRDREKEIEDDQQTIIMEETIAPSNAHAITKTTSGVFHR
MDSSSVLGVGSVGANRLSAARGSSAVSVRKLDKALKLSVKALQSADRPVEPYAGDENMGE
TARERAINLQSTRDMLDSILAEMSSVSGDVVSAAGVTSADRLKKYDLLESSEQLVALADD
LRSVLASRSMADAGLDELADGVTASLVALLQAADLAAKDVAKGNAGASLDQLLKAAGDLS
VALQTLSSTKPIPGVDLASLLAAASDLNSALDSLIGAPLTTADPALSKPIDDARSAVVDY
GRHTVALSALATASDASGIAKLRLQGLVLDDALSSLVTAASIDGVSPVDMQELLRLAGQV
SDALGALRAATDSDPPPPVRPVLALSTLVAADRAAAATTAALDALDDAENDEATAAATAA
LAGSLAPLTGSDPTAPFSLATLAAVPGVDAAALASLMSTASSLATSLASLTAEMEPAALD
AAAGTLGSGLESLAKDSRKAKILAARGVADSAAALLPLAQREAEAESNDLVKAELVASSA
ALSDSLGALQAAITKFEETRSDADLAAVTAAALAVGAKSDALNALRASRQALLILATEAK
AATLAASNTRTVLVTVDSAIDTDALRTAKRAASGMAKPNAALGDSALYYEAEPHGRESQT
ALLDAVAAALPAYAETNLAIGTLTAAGFHNPGEEYLLSKAKAESDERVTALVKAFNAAKA
ANWLYDVSAALKTLQDSASSVAAGISALSAGTFGAKEDALDADTRASRETVARRSASDGI
DSTVAASAALSATLQLLSAESPAAAASGLAAVASRTIAAILDLLAVGETKGGRTRATLDA
AAGLVSALIAEVELTQEAGIAALNRYDGPTPDDAAAVHDAALDAAAELRGSLPGSRGCAE
ALAHIQKAGKPVLAVPLPGDATASAAAAAATAKAAADAAALASDADADEPDAPAPAVPTG
PEYEYEFYEVTVMLPAKPPIPAKPQVAPDPKVVPAPWEAFYDDSHGRYYYVSSETGATTW
EQPPMPAPPPIPAKPTTTTQRKKRRVRVGGRPPVPARKTKPKVPPAPSPVVVAAAAAVAS
ANAVEPMAADGSSPPLDEDASDALGPRAVALASALQGLKLASTGGSGAELDDAAYKVTRA
YPQFADALMAAVEKLPEGSARRVNASQAAKAVTRLAAASVVAAQAVNADRGDADAALALE
QTTSLADVQLRALMSALMGDDARGLDDFTSLLEATQSKNAEIAQMRKVLDSAEASSAEGS
AQVQALMSEIESLNGKLAESKSKFAAAEAERRALEEKAQGETRQQIEGYQHEIATLKERV
AELEAELAALRAQLAEKEGLSHEKLNEMTAERDDALDEVARLKQELADERAARAKLEELA
PELKAQLAEMQAKLEAEKMAFKKKLAEQADFALEGADAKLIEFINSTLASDPHVASLLPM
NPRAVSVATAAADGVLLCKYLNAMMPGSVDERVINFNISDEDDVLMNQSLVINTARAIGC
PALNVTPKALYTGKVPQILSLLWDITRAGLLAVVNVVRHPELFELQASDEEVAAFSRLPP
EVVLVRWVNHHAVARGAPAIDSFADLADGVALVHLLNALEPSTGLGALAQGDPEARAGVL
LQAASGIVGNFSWVTPADVAGGNVRLLLFFVASLFSARTGLTLTEEMELALGDFDEAELQ
GTAEERAYLAWIGAKGVEDVHDLKRDFMDGIKMLELEDKVEPGIVTWDRVNRAKDGKSLH
VVRKVENANLAVTLGRDLGLVLVGIDGKDLVDGSQKLTMAVIWQLLRYDLLRSISSLSYG
GRAVSEQDVWQWAVSKVRASGKPVDVKSFKDRSLSSGLFLIDLLAACNPRAIDYSMVEPG
LTPEEKEANAKLVLGSARRLGASHYLVPEHITSVDPKMLLMLVGTLMEATAKRKGKKK
Download sequence
Identical sequences A0A0L0D352
AMSG_03021T0 XP_013760361.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]