SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03414T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03414T0
Domain Number 1 Region: 1432-1528,1558-1621
Classification Level Classification E-value
Superfamily RNI-like 0.0000000068
Family Cyclin A/CDK2-associated p19, Skp2 0.032
Further Details:      
 
Domain Number 2 Region: 509-580
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000532
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.044
Further Details:      
 
Weak hits

Sequence:  AMSG_03414T0
Domain Number - Region: 1798-1844,1926-2057
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000562
Family All0351-like 0.087
Further Details:      
 
Domain Number - Region: 9-58
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00608
Family Protein kinases, catalytic subunit 0.029
Further Details:      
 
Domain Number - Region: 794-855
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0353
Family Glutamine synthase adenylyltransferase GlnE, domain 2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_03414T0
Sequence length 2139
Comment | AMSG_03414 | Thecamonas trahens ATCC 50062 hypothetical protein (2140 aa)
Sequence
MASPAAVPLADFIESHPLPLARACVFAQLAAALAALHASGRAHGSLGPDAVVVNNATGDV
HVVPPLDTYSVPHPADLVALTALTETPDGLTASDIVAEIVSSLDNPLDMLAVLRACFSGE
CPADLAPCLPLGDLFLPLVKAWLASDASRAIREHLVEDLCGSLVDDALMRLDTAHASLTA
IFAALARCLTRAIIPFELAANVNDGAVSMPILVLACKLSSHAALSSLPTIRRLRAYFLAL
EGEHLGALAVSALALSISRGYLSSTRLAALFISEAVTILDSLLADAVDTAPINSDATSVR
DLDMAAPNSLLLVVTEAAFTSVLSHYVSAAVTNPVPLSLTTLSLSLVPSVLTSPAELHTA
FDRLLFMTHTMIRLHRFDSAASVLDAASELVTAYPELASQSSCLAAERARLRDDDVAAAA
AAELAAAEVREHRGILSFIRAATALVAGGELSGCSLLHDPLPDVLPPYYLRKVATRLDSL
PLDDELAAVLAGPLDVASFVVSVLQAPALQASVAGPRGAFIVHDVFHALAMAFLELLLEK
ATLILGIPPSAFTLVGLGSVARGEMAPFSDLDIVFLVEPDIVLAPECPSLPAGGRDDYFL
RLAHLLELFLLTVGETGYQLGPVSSWSPRGFRLDEAALSPLVTRATPASLVAKQRRELIS
LLTPPLDSDYLDPIAHSLRTAAYIAGDANLFTSYKKALDAFFDRRLMATLVETEAGVAVC
EDAALALHPDTPVRRAYALLALAKNTGAERTFSPWLVDRALLVPDAEVTVDVKTDLQRFP
MLLVDGLALFFGVSAVSTLARLDALYDAGVFNVAVRDALVHAFGFALGLRMVAQLARGEE
NDVLLPSMATPKLVAEIRELVAKVLCPIQTMASHFVTGMIETLARESKPVFEPGTLVRLP
FRDLGYLTETRWRASLDDISDVMYSFGQLDPNAVYTGFGLGMGSVTSWCSLGISAHRAEM
PRWRDFLDSRDAFCAAAAAEDNGAYFYSACSDEVRKLRPDAVAQLFSGSTVTRAYDHGVR
AVATVGNFHFKLDPELPAMELAVHVIGRVLFRGNRTNASPHPGGTPRVDVIKLYFGAEAH
YFLVSETVAGPTLKQLWASAGHNVENYDAALSRVDTPISYDPFSFTQQVLLALVTNPEDG
KEDNYVCEAVDPEQLAYRIVPIDNDHSFVSAVTKSGFFSKRIPRLKCILFCMQEMHDAVD
ADLRDYMLYSVHADALLDVWVDVLEAIDARMASFELPHVRKDMADTEGKPTLDVLFKPGL
VHVLYHKITLIQEVLRGSRVTHMQLLGAVEHELMTLYARAFQEAMNPWARFHLLTESQYK
RGRRGLVTLTPSLVVRREQQCRVVTTADERTSSLWADLTMVSPADLRSELNDLAHEQADA
AVTALFSRSDLRPFRALRLPLFKEAFVERLNFGLFSFPAKLQREVLKALVGTLFRKLVLA
HCVELDDKSLARIIGRCDHLQWLDVSYCSKLVTVGSVAKLAAASICRLDLRGCANVPLAV
VVDIEARCRSLSYLALPEQLGAGLLDAEHHVPLDPRFFLHGQPDLVWSQLEPRLQFGLSL
LVPPQALTQLNKYAKRLRMDLSGADLRDPIVRNVAKVLPHTSAVVSVNIAWNRVSGPVLV
ELAQAFAANPLIFACDISFNGPAAPDELAALADVDAALATTNALELEAVGEDLDALAKLR
LRNLVWNGLADSYHNSLCRKLLRDRSPHLLYKSLAFKRVAQFGFSLPAPVTTALELVDGR
IVLGMTNGSCVVYRPPSDLPPTSAVTEVLSPEEVAERASAQASRGAAASAHAVAVGPFPG
YDSPVTAVAESDRGALLVGTAAGDVLVLQVVARDPRSGEVIKWHLVRTLDRSTYVRSSAG
SAGGAPSDEHPIGRRDPTVKALVALPKKRVLVLIEGSVLDYKTSTGARVALKADPSLPAL
AQYRFAEFGELIHALAPLADWRMVTASAKSVVVWLLLADGTGWSLVASAKLGGVTHLAIL
PNQRISALACGERGEPLRVVTLALDSDASLPKLVQIQEMPAPGTATPRGLCVSGSGLLAS
HWAGAAGNPARLTLWDSREKPFMVQAAQSRRVLRDTSAAAASRGAGDTVNVHHEQGLIPV
LALDVPDDSSFLLVSRLAPVIYELDVSSLALWALRGANA
Download sequence
Identical sequences A0A0L0D3R3
AMSG_03414T0 XP_013760251.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]