SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05890T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05890T0
Domain Number 1 Region: 49-132
Classification Level Classification E-value
Superfamily WWE domain 0.000000327
Family WWE domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_05890T0
Sequence length 432
Comment | AMSG_05890 | Thecamonas trahens ATCC 50062 hypothetical protein (433 aa)
Sequence
MGSWMGMGMGMGSGLVVTVAVDVDVCVGVIWAGGGGAGLDGGMLREHRLGDNGQFQAYVD
KTSRKIEKAYAKFVKSGAKGAGKNGGKGKGKGKVDKTAQVAVTTPVGKYTIDFNDMTQTG
TKSKGTRPVRRSTPEGRARARRAPPVAVRGRRRGRGRPMLPIQPRIDPHFYNGPRRACGS
GRILSGRASTPRSSLKFRARSSRRTRRFFAPGPGPARARARARARQAAARLHSPSRAPST
ASTLSTWSSTGLAIRVSRGRFGGCGPEPRSHRRHPARRPLAAAAARWARSAASGCVARRY
PTRPSSTPGHGRRTGAGRTRSARQSTRRSRSSKTRSLRADTKSGSRPRQPRRTPRRSQRR
SRSSSRLVASGTASRSRRWSRAKSRIRPRSVQSGGSAARIRTCGRHPTRRPARRGRTRRR
TPARHTRAPEEN
Download sequence
Identical sequences A0A0L0DCR6
XP_013757276.1.50528 AMSG_05890T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]