SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05981T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05981T0
Domain Number 1 Region: 189-507
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-86
Family Protein kinases, catalytic subunit 0.000000227
Further Details:      
 
Domain Number 2 Region: 21-142
Classification Level Classification E-value
Superfamily PH domain-like 2.27e-17
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_05981T0
Sequence length 720
Comment | AMSG_05981 | Thecamonas trahens ATCC 50062 AGC protein kinase (721 aa)
Sequence
MSVSGMDLPPLDTSSRNLSVQPIFCGMLLKRGQKRKSWKTRWFAVVVDNQTRSAALVYFV
TRQHARGGSRGKLRLKAAKGLISLRGSVVSKTPATIFKRKHTFHIRTRKGKDYYLVAASA
VLQARWLAGLTRVSGSSLDDELVAMVCKDVEMALNMEVAVGGRSAPGSPNTPLTPLLSPT
SEWPAETDNVLYLANSRQSSFVRKRYTMCDFELLANLGSGAFAKVVLVRKLDSGKLYAMK
MISKSRLKKDKQVQHTLAEKEVLGKLHHPFIVQMRMAFQSVTRLYMVLEYAAGGELFYHQ
RQQGRFSTPRVRLYGAELVLALEAIHDAGFVYRDLKPENILLDAEGHVKVTDFGLVKQIS
DSVSGATTFCGTPEYLAPEVIKGHAYGLAFDWWNLGIVLYELWCANTPFLGRTDLEVYEA
ILAGKIGYPSCIPDDGVELLEALLCHDPIERLGGGRRGASEVKAHHFFAPLDWSRVARRG
YTPEFVPPTAVLDDALNFDPEFTKEAVSPGDAEFTPASSEQRASDFGGAFQDFSYVSPSS
FDDDCTEPSKFNVLESSFHRVDNDDDDFDSSLQLPLSPSAPDAPDLPKWDVQPKLPSLLT
KSSSDFGFSGVTSGSSSAMLSNLTTMSSSTLNESAAAKGRAHVVDNEANLADDGRHATRR
HTAKAKAKSKDKDKAKSKDKAKSKAKAKAKAKSKDKAKSKRRPDASTPATPLPSAIPMAS
Download sequence
Identical sequences A0A0L0DBJ6
AMSG_05981T0 XP_013757505.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]