SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_06353T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_06353T0
Domain Number 1 Region: 225-331
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000015
Family Second domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_06353T0
Sequence length 2822
Comment | AMSG_06353 | Thecamonas trahens ATCC 50062 hypothetical protein (2823 aa)
Sequence
MHKPCEGYHVSLTPLTLEVQVYEVDAGRGRQVAAGEPQTVTLSPLATVLSACNEMALALD
GAVDGQNSSPHSPFQGWGLYRLIPDTDRDKDADESYGHLDYEATLAAAGVTTHTSLAFLC
RRVVVPVRIGPNGPLVSVPIDEAWSVYEIVDEIAAAHDSVLHPEEYSFCKADGHWLVGSL
SLPAQRAWSSLQTWPDAPAELVLTRKLYFIEAHAEALANLGPDAPDATLHLLYREASHLV
TSGALPVTEKEAILLAGLALQIAHGPRANAPPDALPQEPKDLACFLPPELAADVGAKLAR
KIARKHATFATTPRGLALSKYIKLVRSNPNYGWTFWPMKERVKAGRRFRLVPRLLGLSGS
GLKILNAKRSRELVVAAWLVIESVSGSDVGLGPSVVFNINNPSYADEPLVIVVESDAHVR
DIIGFCNDYVQLATRRSLASELVLTSCASLASLSQPSWDALVEPTSRRDADSERSEPDLE
ANHALPTHFTLNRLRGLDHAGSSSSVARSSSLSSLPAYVSEQWDSLLVAPQVDAYTSTTS
LFTTEFTTGSEEEGVLGRALQLQNAASASTFFTSGMYFLPLLDDAPPTMEKLRLSAKASL
AAALKPFSDLAATGKAALASGVSDGDEPSPSHALLVMAASGELARDALASLALALLELVM
AAAGDTTNLLLPEAAAASAELAFDALHELVARLAAFAGVAHLVRSQLPDADGAYAELWVP
ASQASGWRVPGELMQATELLEAASAAVCSVVADARAVLIAASHALHHMEELAPEAPPSRA
NTAAGAVVADAIAIPEEQTSALLTSGKRAGSAIARLATLLGVSPLAADLVDELDTQAQAS
SAAALALTNATAHDAFATLARTRASSLRVELNALPDLTRMLQRSVGIVSAAIKLGPVHHV
VAAKIKVASAVVSSTVRSLPHELPVNVPPLREAIISSLSAYQAAVDDVRPKVQPLTLTAR
DACLALINASAAVLAELPRLDGDAAALRKASLAVAGALASVGHCLRNAITILDSNGSHLV
LLKQLSAVSRLLVTANGLASQPAPPADQMSEVLVRASALGRWLHLDCDYVLATHDLKETL
AGSLVTAARLVVAEQAESDMHMTLGRDVSELRSDLARLALAPRSMRAADALFSNVSRYVA
HASAVVAAAAGAPTAELTAFSDSLARLAVLQQAAVQHSMAAMIAMYISDIDAARNRVCDA
LPSDEALDEPQTAGGEGSPTSGDMPAFSDSCSSDAFFASGSVADLLEALAEAEPGVDVHD
DDELLGSSTASLGAQADALVADIDSLLDQLGVESLAEAMDDDSVAISGSGTRASVAALER
ELAQSSSLAEAVGHYNATVSSLEASGAAVYAAARHVASLPNARARASYAARAAMDIHSAV
VDARLLVATVMAMWPKIYSQQAVARLKNVTLRFLSALGALLAVVRDLVSAVDGHVEERIA
ECKAAMATLKTAPPGLGMLSVLADELSEALDELRNPGVASSDTSDDGARSLDDIVDVAEQ
AVDAALRDGPGSIPRAHGGGGEQLGKTTAEQGFSELEAILRKCARLVTATLDELVTRPET
SLNDVEAGAQLVAQVMRALTTCVVGLRGTIQLAQEAPALRASLAALVSKVRTKVDDARAH
VLAGKGGLPGESVRDNAGPWMAAFDEFFAAFDAAVLAAQGSSGQTGLDVQRAVETATAGA
ARLEMSELGETERASDKRVASELRSVLDSSETMQATLNGMMPLVSWQGEASARSGTWPGL
DGKVPELAVQSAIALANWVEGTVRCVEVLGGVPAGVAPTPPSSPAGAQAPAPAVVPTRPV
WEAISSEFKAVMVALTTLKELADTPGAVARNVRAGYTQLVLAVRDILLVLKEGVVTDVAE
PGWLVKSEGEAKMLRKAGSALKTAAMKVVKHCDTQLKALRPTQPVAGVLKAKAFRKAFKA
TVSKLLAVKTAAEEIECVPAVSRGRLGGRGRAVPAFTSVTQVGERLLASGGQASWVLDLS
GDEVAALCELVCDGRVLARLGRGAALAVVDALASLKTLAEPVDAVVSVATACAALEHACD
MVDAVRGSVALLSPTTVGALEVLVQARQLLRAIEDATSASKTNAGAQLDAMMSAAADAFL
AEIDRVDDALGGYAEVVASGSMGVNFVAARAEVCEALGSVADVLGSGVCASRAQLRALSR
ELSTLVRDGVVPLVSCVLSSPLCADKECVSKAQAKSGEAICQVRKVFEADALALLDAHAW
RSSLIATMGKYVGDASEVDSSVVLPGLGYSDYVRKTKSHVVESVQAAQSLIDAAKCEQGR
LGVAARTLVEATEGVLKCVCGALSQTPASASDVLDAVRKASKTLAWTVARLVETCVDLAE
ASKADRASDAGRAAVISTSQRLVDAVSSLMCELKAGAVDAQRQRAALDASAALGSQLKQT
RLVLQSRSSGSASAGASEALGAAAEDALMIFLEEGVVETLGRAETEASVADALENAAKQL
ATAVAQLVELANAVETDVGSGVCKAGVEVVTAFCAAGADAAAHCGARQSSKRDAKLVSAV
SSRVMALVRAVRAASEAASRMSSEVTALAARVSSDVEALAELAALDDDGDEWCDAAAREQ
GAARVGAALRGLLDAIGQVWLGGASRSRASVLAAGHHVASRVEGVVSAMRASAAALGRDW
VLLSGEVWQAAEEAHEVVERLLESEVAASAAETAWAAVVSAMIVAASASRLDGPGDASMA
AVSVMEACAENVAGVSGDSEMSNLAHGAVGAVVMLTKVALLGLAEAEGLGFADGATREEL
AGCVRGVASALESLAFVAVASGETEEAGQAYSEAVNRVSAAVVKLISANNELVARGGACA
RR
Download sequence
Identical sequences A0A0L0DFV4
AMSG_06353T0 XP_013757043.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]