SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_07374T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_07374T0
Domain Number 1 Region: 761-1162
Classification Level Classification E-value
Superfamily RNI-like 3.92e-64
Family 28-residue LRR 0.0059
Further Details:      
 
Domain Number 2 Region: 9-115
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.95e-20
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 365-475
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-16
Family Second domain of FERM 0.00089
Further Details:      
 
Weak hits

Sequence:  AMSG_07374T0
Domain Number - Region: 281-360
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00283
Family UBX domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_07374T0
Sequence length 1178
Comment | AMSG_07374 | Thecamonas trahens ATCC 50062 NOD3 protein (1179 aa)
Sequence
MVRHAKDMFVAVAHGDKDKVLALVSKYGKELLDVHEPTKGTVPLHFAVIAGKLSMAKLLI
KLGCDINATSSTGDSALHLAVMKDKEKIAKLLIVKGIDVHLENSAGKTAFQLLKLKRKAA
AKKKGAPTNRERKAKLGGGEVDIGSGSASGDGDNAIGKAGRAGGNSLDDESSDSDSGDGE
DDEFAAALRERFLSQSRTGRRMSVRRQGSDDLHVRGTTAMATDDDEAEVAPGPYEAPYPV
VSSDDQPTPSIKRLRAKLAGRVRQFAESSQPRVSDAPKVILSILLPSGSRKKIAVPCDYT
GQELMDVFASKINLAVNDMFELVVLNTKTGRIQDFIDADRTIEDHELKPSDLISFRTKFF
KMPATPDPVILNLLYLQTRNDVTSGQLAVSEPLAVNLAALTLQITHGKFDPKVHNLGFLD
ESALDDLLPRHLVSRYALSLWQDRMFVAWARNDQELTGDELVQQYLARAREAPAFGGTHF
DARGPGSVPASIAVVEDGVLIRHKGEPYTFFSLFRRTPGSDENELKSWRWDAEQVLFDVV
EPASGEGASLLSYAVVGGADAARELVELISGYYILLVFGDAVPTRPMLMLDDLPVPSEPL
PMRTVMQLPQPRALDYAAPSRLALLLETYVEECAKAGTAPLASVLAPIHAALDAGTPLTL
LNMGAPQADSSLHATAQIAATEAARKAELGLVARGGGAGPSGGKAGGKDSEACAFWAPNQ
VLALATALRKTRKVEGLPVDDVMVSTVSFAQSRFGESKACLGAVERVLSEVGDAFRVEKM
DLSECALTTEKQWIVVCAALRHTAPLTELVVSGNAMPAKSMLELVRTFKAGVHANQVFAA
AACSLGDEHVVHLGKRLYNNASTLTALDLSGNKITDFGLEKGILVNMGRNTGLRSLAFSR
NNVTSKGVRALLALVEEKRTLTSILLSNCHISAKECGVFSARLSINSVQVLALAGNSLGK
GVATFAPHLTKASGLTELDLSDVSLEKHGIAALVETLPTVRNLRTLSLADNGISTKDGVP
LVGAIGASRSLVTVDLSGNSFKKDFAEALGSALAASTSLRSLSLASNKLGGEGAAAIGRA
LAANGLALTDLSLAGNKIGSGVDALAEGLTSNSTLISLSLANNSISGDHFMEVVTALEAN
TGLRHVDMTGNQRFTPAQIDTIIEPRDISCEIYVSFAS
Download sequence
Identical sequences A0A0L0DJ50
AMSG_07374T0 XP_013756276.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]