SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_07447T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AMSG_07447T0
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_07447T0
Sequence length 141
Comment | AMSG_07447 | Thecamonas trahens ATCC 50062 hypothetical protein (142 aa)
Sequence
MGEYLAEHGIDVFLNDALTLAAEVLPEKPAAFLAAYFDAVDSGTHVLGRSMEFITACAYN
AMSAGSAWREAYAGLDASMLLSGGDAFELTVRLFPDLPQEVVEAAMARSDREVEAGVTVA
SFAQLLAAELNSRVAHRLPPR
Download sequence
Identical sequences A0A0L0DGU3
XP_013755949.1.50528 AMSG_07447T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]