SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08993T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08993T0
Domain Number 1 Region: 171-238
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000144
Family WWE domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_08993T0
Sequence length 407
Comment | AMSG_08993 | Thecamonas trahens ATCC 50062 hypothetical protein (408 aa)
Sequence
MHQRQRQRQRRPQQKQKQRQSKSKGRGPRGKFARSESPPMASLLSGNQQDPLATSPPSAR
SNRGRAGRGKAGRGKSDRASFRNSSSRGKRSSSSSSAHGASPPHREDGWGSSGSSSRNNS
RKSRGRGRGRGRGGRGGGSGWSRRGEGFGGDDGGMTFGMPGSRSMASDTGGGLFAQWSWL
DDSGPQNYDPASTIILNAAYAAGESSVSILNDRYSVNLERMQQMNNGSGYVRDVMRTPLP
SRAQAESYYLGVVEELVALLPASPSEVDSLDRRRRFLLGSPKFVISRVMSAFMQVSQQMR
NEASPTRSVGVSEAIAGLNSRVKKAVFIYARASGESSSFGQAYGSAPCKTAPSYGADGFI
KAPWSALGILCYAVGPNGRERRDRVVRWRVHDVHLADADAIFETATG
Download sequence
Identical sequences A0A0L0DLC9
XP_013754949.1.50528 AMSG_08993T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]