SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_09621T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09621T0
Domain Number 1 Region: 969-1122,1158-1286
Classification Level Classification E-value
Superfamily PP2C-like 3.4e-58
Family PP2C-like 0.00016
Further Details:      
 
Domain Number 2 Region: 530-739
Classification Level Classification E-value
Superfamily L domain-like 1.84e-39
Family Internalin LRR domain 0.027
Further Details:      
 
Domain Number 3 Region: 747-921
Classification Level Classification E-value
Superfamily L domain-like 1.93e-27
Family Leucine rich effector protein YopM 0.019
Further Details:      
 
Domain Number 4 Region: 164-270
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000628
Family Second domain of FERM 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_09621T0
Sequence length 1286
Comment | AMSG_09621 | Thecamonas trahens ATCC 50062 leucine-rich repeat protein (1287 aa)
Sequence
MNGGNGSGVPRFVRVLLVDGTAKSLALGPATTVGALLAALAEKIALPVAAAVTDASAAGE
DAEGEAAAAAGEAPGAGGHVADGPFTLWALDDDGSELGRERLALPLPADLVLAKLLEVWP
MLADAAAVRSRSGDSATAMAVPVLSVPVLRLSRSPLAPGKLWHSQDARVVDAAYREAVAL
VLSSAVAVPSSMAVALAGMHAHVAYGDFNSAVHLPGFFGAGVDSMVPAAVVSGKGYKRGS
WEKKILAEHRKHALRHPLLVKLLYLHTLQSVSRHLNYAFFCSSSPDAALPLAKRKRSSMS
RFKLPVARLGVNADTILLEVPAPKASAAPIEYMLDMRSPDVDMRVEPGPLLDPTSLLLVT
VSSPAAVLAPPSAWAQAHGKNLVFAFTSPLAAYLLALLEMLGSASPRLPPFEMLLADPAE
ASSRPGTPRAGSAPSSRVSSSSSSSAAASAASASASSAAAATTAAAGGAGAAAAASSKAS
SGRQTPRAESPQVGDATPLALIKVAKDANYSKLALESVPAELGTTQAQATVCSLRLDRNQ
LSRLPASIGSLLRLTSLNLSYNDLTELPTELGLLSNLTSLELVGNALTEWPAAMSSLDKL
EILDLERNFLRSLPSSLVGLRSLTRLQASKNEIADVSEVPWSSGFEHLVLLDLSHNALTR
LPASMASLLTLRVLDLRNNALVELPDMLSQLPVLFKLNVSDNKIQQLPASLFDLDALKDF
NADRNELTGFATPSPAQLKNAKRSRLLPSLTTISLVSNKLRAIPEVLFSLPRLLLLDVTD
NQLVSIPPSIGKLKNSLCVFSAGMNALEELPVELFACKRLQELSVPCNTIRVLPSKVLSL
SSLWKLHVGDNELVALPNLSKLVSLGELVVSGNALTSLPSWVLTHPGLEAVYAARNEITA
LMGSRLTAPLEVLDLEHNRLTADAMPSALLSAADGVVHWKHNPGAPTEAKPMQGVENLVG
ELLDPVVLNEHAARFELGTADMVGVRESMEDALLVGWQLWSEPDGSPVDLFGVFDGHGGS
FGSKFAADTLPDVVTAMRRDDGRPALLEGSATAQFEAVATLLSDALRKTESSLKSAIKAR
LRKMPRLKFVGSTGVMALAVAKKLYIANIGDSRAVLWVPALPSGAVLGSTGPVAQVHKHQ
PPPDYPWTHLEASSGFIKRLSHDHKPESADERTRIRSQGGYVGDECRVNDIVAVSRAIGD
FYVKPYVSLCPDITGPFELDGLSGSVLVLACDGVWDVLSDGQAMTTILAELAAPGPDPCA
RAASRVRDLAYQLGSGDNISVMVIRV
Download sequence
Identical sequences A0A0L0DRA0
AMSG_09621T0 XP_013754175.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]