SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_09813T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09813T0
Domain Number 1 Region: 279-400
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000314
Family Second domain of FERM 0.0011
Further Details:      
 
Domain Number 2 Region: 599-647,684-735
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000826
Family Second domain of FERM 0.0042
Further Details:      
 
Domain Number 3 Region: 195-283
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000122
Family First domain of FERM 0.018
Further Details:      
 
Weak hits

Sequence:  AMSG_09813T0
Domain Number - Region: 877-973
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00222
Family Multidrug resistance efflux transporter EmrE 0.013
Further Details:      
 
Domain Number - Region: 1054-1134
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00798
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_09813T0
Sequence length 1170
Comment | AMSG_09813 | Thecamonas trahens ATCC 50062 solute carrier family 35 (1171 aa)
Sequence
MADEEPKKKRVRKVVRKKVVRKRVVKRVRKKSSATNKADGHSSASAGASAEASTEAEAEA
AGHVKAKRKVVRKKRVIRKRRDDHHSSHDDGEPAAAPAAAPAAAIAAKADSSAAPAAAAM
GVAAEGSRSGSGEAAKDGGSLSSSSHADTTLVPEPTAEEEAARAAAERAALEARAAERAA
APAADEPEDRPEPTESVIVTIAQVDGEAKSKLRVNEYTTGQELMDMYARKIDLLETQLFD
IALVEDGEDGLDVGEFQWIDRDEPCLAQGITSASFLQIRVRYFSQNVGASTDPTAVSLQY
AEVRARVLASKWPTTLDQAIRLAAFSFVSEYSGYDAAKHRAGLLADNLATVLPAEHVPKK
KKARKKVEAAIFEAAALISGTIKVMAEMNYCEYAAGLPDYGVQLYVLTQAVDGAQAIGVC
PRGIVLYADAEGRSQVRIASFKAELAGAVATVDSASPTVVTAGGLRMMLPSAAQASAVAN
ALQAYAAYAASGALPLRADAQLTREPTTMTLRIRSGWPGDKGRLITIDETATVGELMNSY
AELLRVHDRRWLGLCDSTADADRWLNPSKLVMDEHVHVGSTLVYKLRVIVLNERELAKSK
DARARHLYYLQFRQYVLDGTYTVTEDQAVLFAAYRFLADFGSYFPPETEIDGSDGDVFGG
GSEDDDELPPDPTTTKGYLVAQGIERTYIPHYLRVQYTDSEWEKRIRAKWRELGDLGNAT
YVEKLYLEEILKLNSFGVEYFQLYEASGGSNEYGGTAVDTVLLGISQKGMALVRPPHFDV
LARFPWPVTRLTNTAHAIKVEKASKTAAGQREWSARILHTISPLQGTNIRILASMYQQIA
YRPGLFTFFVLHDWLQEQVVKVDGFHHGLTLTFVEFAAVALGSAVTLHLSRSLRVRALGA
YAVLSVAMLASMASANLSLQYVSFPLKVSVRSGKLIPTMIVGSVMLGKEYNRGQYAAALL
LCAGLVGFTLTSRSQAKAAAVQLPQSQFYGGLALVVGSIVLDSIVPNLQECVMGRLRRGT
YETMLFTNIIGASVLAALAAMSGELGPAVRELVASPMLLLRLIAFGSSTFGGVTFYMRLV
RAYGGVTTVLITTTRKIITVTLSFLLFSENTFSPGFALSGMLIVAGIAVNTYAKSSGTKA
GGHSTTSAPRATASQLVGRIRALASRDEPV
Download sequence
Identical sequences A0A0L0DNH1
XP_013754242.1.50528 AMSG_09813T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]