SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11286T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11286T0
Domain Number 1 Region: 236-597
Classification Level Classification E-value
Superfamily RNI-like 2.12e-69
Family Cyclin A/CDK2-associated p19, Skp2 0.032
Further Details:      
 
Domain Number 2 Region: 2-313
Classification Level Classification E-value
Superfamily RNI-like 2.35e-67
Family Cyclin A/CDK2-associated p19, Skp2 0.014
Further Details:      
 
Domain Number 3 Region: 551-724
Classification Level Classification E-value
Superfamily RNI-like 3.77e-32
Family Cyclin A/CDK2-associated p19, Skp2 0.073
Further Details:      
 
Domain Number 4 Region: 999-1062
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000019
Family Ankyrin repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 772-919
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000068
Family Ankyrin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_11286T0
Sequence length 1167
Comment | AMSG_11286 | Thecamonas trahens ATCC 50062 leucine Rich Repeat family protein (1168 aa)
Sequence
MCPNLTTLDLNNCSNITDAAVIALAGGCPNLTSLYLENCSDITDAAVVALAGGCPNLTSL
YLENCSDITDAAVIALAGGCPNLTTLDLNNCSDITDAAVVALAGGCPNLTTLYLSSCSNI
TDAAVVALAGGCPNLTTLYLSYCSNITDAAVVALAGGCPNLTTLYLSSCSNITDAAVIAL
AGGCPNLTTLNLYNCSNITDAAVIALADGCPNLTTLYFLKLSSCSDITDAAVIALAGGCP
NLTSLYLENCSDITDAAVIALAGGCPNLTTLDLNNCSDITDAAVIALAGGCPNLTTLYLS
SCSNITDAAVIALTGGCPNLTSLYLENCSDITDAAVVALADGCPNLTTLDLNNCSDITDA
AVVALAGGCPNLTTLDLNNCSNITDAAVVALAGGCPNLTSLKLSSCSDITDAAVIALAGG
CPNLTTLYLSSCSNITDAAVIALTGGCPNLTTLDLNNCSNITDAAVIALAGGCPNLTSLK
LSSCSDITDAAVIALAGGCPNLTTLYLSSCSNITDAAVVALTGGCPNLTTLDLNNCSNIT
DAAVVALADGCPNLTSLYLENCSNITDAAVVALADGCPNLTSLKLSSCSDITDAAVIALA
GGCPNLTTLDLNNCSDITDAAVIALAGGCPNLTSLYLNNCSNITDAAVIALAGGCPNLTS
LYLNNCSNITDAAVVALAGGCPNLTSLKLSSCSNITDAAVVALAGGCPNLTTLILDYCSK
VTLDLRRARTAIVQPDFLASQHARALLDVAQAQPHPVHAIDRCNLLSLSALNTLLANGAD
LYDLDDDNKHAYVHSPASSAPVFVGLMIESLRANADGATKLANGINKATVALFVVLRASP
TVPISADIVSELVTAGADVNAVEPTFNTPVIHVAAANTEHGALKALLEAVAALDIFLDQS
AVDGNGATVLDTIIAANQLTAERMAELGGVGLDPFMLQPDNTHVYVAAPAERSAAFSSAM
VAWIREHGDGATELTNGINKATLALFVVLRASPTVPYSIPVFAFLIHSGADINALEPIAG
LRPLHIAVLLSNVLATMALLAAGADVWAPNHIGVPPLSTAAIELAEPKSREVYNLVTGTI
PVPAAVDDFVQEAIAAGGVVDRPAASGNRPRSRVDELEAELSATRDELALMQDKLTVAEG
DIRALRDDRVKLIQHFDEAVANFQARR
Download sequence
Identical sequences A0A0L0DU36
AMSG_11286T0 XP_013752821.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]