SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12367T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12367T0
Domain Number 1 Region: 2332-2508
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.24e-29
Family I/LWEQ domain 0.00045
Further Details:      
 
Domain Number 2 Region: 1872-2000
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000000847
Family VBS domain 0.017
Further Details:      
 
Domain Number 3 Region: 173-271
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000124
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 4 Region: 332-412
Classification Level Classification E-value
Superfamily PH domain-like 0.00000027
Family Third domain of FERM 0.0072
Further Details:      
 
Domain Number 5 Region: 2553-2690
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000471
Family Growth factor receptor domain 0.021
Further Details:      
 
Weak hits

Sequence:  AMSG_12367T0
Domain Number - Region: 742-816
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0177
Family I/LWEQ domain 0.01
Further Details:      
 
Domain Number - Region: 1209-1334
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0235
Family VBS domain 0.051
Further Details:      
 
Domain Number - Region: 2109-2242
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0706
Family I/LWEQ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_12367T0
Sequence length 3092
Comment | AMSG_12367 | Thecamonas trahens ATCC 50062 hypothetical protein (3093 aa)
Sequence
MSEPSQSVAVTVQVYGDTQANRDEVVQSKTLRLSLSLTVSEAIAEIARQTRHSPDGRGLY
QPIGPGVVEPRWLVEDQKLFGRVSADSELYFKLKMRRVKVQILGDKATVVQIDDSLVISQ
IIFKVSEQIGLTNPEEYGMKRPEDKDDYSKWLPLDRTLENAGIMPGDVLLFMKKLFFYDK
FIDEKDEVALNMLYCQTRDAILNCSLELESEEEVALFGSIIYLDTVGPYDDSKGEPKLTD
LSPYVPNISKWHKSKKLAAAIVRRYKALGGPTLKKYTSAAGAPDHQAYQAAYVSFMAQNK
SKFCQIARTKPLYGYVYFDASMKRRRRRALRKSNKFEAMPVVLALGRDYFLVLDPKKDRE
IVIEHHYQEVLQWQGTGNKLTIDCAEYEDSLLTFLTSDAEPIAEYLRSYISLHRRRVDDP
LADPAALTGADDDAIATGDAGGAGPSGRSFAVRPPASDDDDVPHDIADVKVLIEALPLDN
KTIVEGPPLDAPTPEHRLVVTTKTKDAISSQLVEASKASQALLLAALTPGPDAAGFDAAD
LLRAARSLDDALNSLVGHVGTAAGISDKDGDDCLDDMAKLAANSSVMVKAATVAALGTAA
GEVDTIALSDLLEASRDVGFALKNLLGSTQVIGTVNDIPELPANMLDLLAAADAVAAALK
DMTGLLPRLSSTDPDSPEAAVAAELSSLSLEGDKLRSTLSLAAVAYADDDQLAAMDSKVE
ALRLRLAALDDLLVTLPPGADDLLAAAAAVRDALATLIDAKDSVVHPADRSAEVEDAAGL
VKADVAELIALVSSDRLKKKRLLVAMKGVANDAARLGLLADLEAQSVIDSELQKSLLAAA
KDLSEAMMNLISASTSLSKSLDSEKKRAKTITAAANVGDYASQFMMVRTRIAAMNTLVAA
SKSTLAAVELTVTEAALELNDIRNQSRKADLDRAMTAVTAPADALTHALYVFLAAPNDSA
YQAELISSAGTAIRKFTILAQVGKAAAALSDDSIYLLSAAQALADALATLKASLKDASTA
CWQLEVDDALANMRESIDDVTGALADHAAGTLAPESNATQQSAQDELLSNLTSMAGFIVL
TSAAVLDARAAELSSSIKAMADEIQYLVDAAEAVAVNSSSSATTSACLVAGKDAADATLA
FALVAKAGMLHNSDPQLAHKLDATATALSATLVALRQALPGIGTIDVAISQIEAAAACLD
PRALPPVDADDVFDDAKVELSGAVRALASGLLQLHPAANESPDALSHAVSTVLDLVKSVL
ALSMNCAALTSVSTARASIVASARAAAESIVAALAATKAYACDFDSPDTATALRAAADSA
ASALEVLLRALASGEMVEGDSVAANCELAAQRIEAAAKRLVLDELPDGDEAAFKSAQAEL
LGAAKELSQATDQLALYAKAGKAKKTGAASVELADVTVTVVDAVLTAAASLPGTGPSGLS
PAAFKPAVKDCLDAIRTMIQADSAHKPDKALLKTVAAVGRAVMALASALNDKAELVDDDA
VVNEMAVYATALQKAARKLILAAGAYVPKRDDSDLHSKFLSRAKNVAVKCTKLNEFAKIR
FASTGRASAASSSAALALALRQREMIDASAATGDAALTNPDSGSLSSVALAALGPAASLG
QLPPGVAAQLNLLSLAAELADALGHLVGAAKMSTAAPDDASSSAMLSSAAAPVADALDAL
IDATRYAGPGEAACERAIATGSTVVAKLADAGLNISVGALALAPSPDHGLHVNDLLVAAR
ELSDALNALVLAAGTSPKALATAGDSLAGVVGKFGAAALTVATTSADVASAAQTLRLAKD
VVEQANSVCSAARDAGGDPDARGALKATQTGNALTLETLQALVDFLGSLAASGHDCDVAI
VNIENATRALDRKLAPPATKAHKELERALRAAAKRLVGAMAKIVHASKDTPSELGAASKD
AAKIFPDLVAVVIGESALVAGTDAAAALDAAMRSLADACIGLVEAAKAVELSPKDAAAKA
GVSGASEAVTKDITGLLLASKAVGALQKESEEAKRVIEEALVELSTSLYLASNEQLYVRA
TQSYKSHENAIDAQCKTVAHAVSEMLKAADGPLAALGTIALHSAEAVKHLVLIVVAAASG
LDAAALQIPLLNAAKALATAFVTFIDACQANGEASGGAKKHAKKAVKAAAKAVAMAIAAM
INAAKETAADAMAGTKALLSAAAKIAKARDELAAGAASPAGAHGSVSGEELIPAAKATNT
AAAKLYFASTKGQDVIAARANDLAASAVPLLALVAAAAAAPGLPDADVSGLLSAARALAD
ALATLLERMQDVSAEPSDLAPASRAVGTAVADLVGVASFLGQAPADLSDAPADVAERALN
SAADSIDAAAARLRELQAEQAALASASARYSSSLLGSCLGMADATAELVRAAQLAQAEIV
ASGATHDGEVFHADPKWAEGLVSAAREVVAATEQLVIYADAFVKGDGDDAYIVAASQVVS
SATAHLVMAARAKAASLVSEPQVRLDKAAKAVKRATRDLVSTVEASIEDDVADNGNRSLS
IREKFERQEKVRRMEEELARLQQNLNKALYPLICAPCSEGSFSYTLSAEACVAYPACPDH
TRRVSKGSTLFAPPCVCKPGYYAPRLVPDVACVACPRGGVCVGDSLRRPSAAAGYFDVSN
VTGAVLQLEACPRPSACMADSQCAEGTSGFMCRVCGSGYYTDADGDCAMCPGYARAAFAT
FLVALAVVLVAGLAGVIRLTYRRGEDMRALASLPHGVKAGVLFVQTLAVIGSATLLKWPS
AVFALLNTFSIFNLTISLVGAECVLGGFVETYVLSVLLPTALVVLIAFAAGCARWLCGMG
HVRLGAVVQRALCVLGPMMYITAAHGSLLLFDCTRLPSGEYVLDADVGENCYDAQWYTML
PFGLYAVVMYVIGLPAYVGIALWRSRRVLHEPQIQIKLGILYRAFKPQFYMYEVWLLGKR
LVLVAASLFFSRLMVWLIFLLVVLFASFAAIQLRLAPFRLPAHNRLELQLDSIVIFLLLL
GAFFWADDFPNPVSHALFVVMAIAAICLALLLVLRTTLREFRGRRKQAAAVGVEMAEAGG
SGSARSLSSVVLLSEERSEEESDSASVLSVSG
Download sequence
Identical sequences A0A0L0DTW8
XP_013753531.1.50528 AMSG_12367T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]