SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12449T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12449T0
Domain Number 1 Region: 768-878
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-23
Family Second domain of FERM 0.00025
Further Details:      
 
Domain Number 2 Region: 686-741
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000975
Family Ubiquitin-related 0.083
Further Details:      
 
Weak hits

Sequence:  AMSG_12449T0
Domain Number - Region: 432-463
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00034
Family Formin homology 2 domain (FH2 domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_12449T0
Sequence length 888
Comment | AMSG_12449 | Thecamonas trahens ATCC 50062 hypothetical protein (889 aa)
Sequence
MNPPPPPPPPPSHSQPLHPSSSSSTSSSAEPSPPSPPLPNMADAAASRDDGAEESSEARD
GGPMSADGGNKQLPSPPLPPSGAPADLGTNYAAAECGARVLSAAEHVTNSGNLLTPHRDS
YLLAPCELGSWVVVQACDEINVRTLELGSLEMFSSLPRAFELYASDSYPEPSWVLIARFE
AAPKRAVQVFNLPPSAPEMWTKYYKLVITSHYGSEYYCPISILRLYGTSVLQDFKDGLVN
HADDDLPVVTVVSPPAPLPPAAVPVAPGPPPMSPLAPLSLPVNARPLSLRRWPLHHPMCV
CSLSAATCGCSPFSQLQLPATNPGPGSPPLLPDAAMASPLPAPPPLSNNAIHRPASTLSP
PSPAPVPSTPSMPLPPLDGPPTPPPPSPPPAPVPPVETDLETEPAPSPQEPGGPASGSPD
VPVSDTGSPQQPAPPPPPPPPPMTMPEPGESTGSVFKTLGKTVRELQRQQTKASLYLESL
STTYTVALDELQQYQRTQDARIAALEAALAEATAARLAHASKLAELQARLDSADALHPWL
RLGLESPVSASVVVLVIAVSTASWVVLCASRSLGSDTTSPVSPSAAAPPLASARARARAR
AAHGAHAGHAPATTDAADGVVAVKKVAFQVDATVANMCSVLTSKFHLVEEGFGLFFPPSQ
YRTSKWLMANKTAEFYDLKNDELLEFRLRHRPLRVRLPDGVYKTVVIDENMVVAEMCKAI
GAKVGIDNVAEFSLKIEGSSAVEWLLRNKTLIDQGVDESVALEFKQRLFFTDTEVNLNNP
RELHLLFEQCRESVLTGNAVCSFEEAVELAAYQLHLTFGDYDAASPPSFDIGEYMPPEYT
KLKKASRLILEAYAACVGTNMEQAKYQYVSVCRGLKTYGVTFSPLPRP
Download sequence
Identical sequences A0A0L0DV20
AMSG_12449T0 XP_013752718.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]