SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur02g03950 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur02g03950
Domain Number 1 Region: 68-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 29-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur02g03950
Sequence length 120
Comment length:121 (n/a) (lipophorin receptor)
Sequence
MIYHSLFIAFLLLLLSFIQPSYQACNKVYQYECPKSRECIGKAWICDNEPDCSDGEDEEP
FMNCKELKCNPQTQFKCQHGQCIPLNWLCDGFKDCPIYNDDEDETMCRNMRQRKRNTRFN
Download sequence
Identical sequences T1JVB0
XP_015794347.1.93521 tetur02g03950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]