SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur10g02650 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur10g02650
Domain Number 1 Region: 34-170
Classification Level Classification E-value
Superfamily EF-hand 2.45e-32
Family Calmodulin-like 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur10g02650
Sequence length 180
Comment length:181 (n/a) (Myosin regulatory light chain 2, smooth muscle isoform)
Sequence
MTTEKKKKSKEDGESGGSTKKKAQRSGSNVFAMFTQNQVQTFKEAFQMIDQDKDGFISKN
DIRQTFDSLGRMCNDAELESMVSEAPGPINFTTFLTIFGDRVSGTDEESVILNAFAQYDE
GEGKCNEETLKHAITTWGEKFTADEWQTATAEAPIDGSGKIDIKKWARMITGAAEEEEQA
Download sequence
Identical sequences T1KFC7
XP_015786276.1.93521 tetur10g02650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]