SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur20g01350 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur20g01350
Domain Number 1 Region: 148-268
Classification Level Classification E-value
Superfamily EF-hand 8.22e-20
Family EF-hand modules in multidomain proteins 0.025
Further Details:      
 
Domain Number 2 Region: 13-130
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000129
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur20g01350
Sequence length 299
Comment length:300 (n/a) (unnamed protein product)
Sequence
MSSNNETRMESTFLKVNRRGGLMNRRIIIDEQNKTMEYHRYRKKLTFHKKSIYSIQDITD
LRQGWMTTKFKKIEEKMRRLWMKGKQDTSNNWVREECSFSIVFGTDKTFDLIAADSIERE
FWLNKLRYIMFEAKTAKKTKDRRAFVEKCFKEADKDGDRFINFFEAMSILNRLNIAINNE
LAKELFQKSAKKHSTRKSDEEVLDLDEFFIFFDSLEHRWEVDKLFRQYAKSGGTTMGPEE
LQQFFKEEQGIDLSLDTCQKYIDKFQTSWYASLSTNLLEASQRQPASSQILELYMNSKG
Download sequence
Identical sequences tetur20g01350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]