SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur01g08860 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur01g08860
Domain Number 1 Region: 46-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 84-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000301
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tetur01g08860
Sequence length 253
Comment length:254 (n/a) (unnamed protein product)
Sequence
MKALRMFSFILIILIVPRDLYAATLSQYTANPAPSYQYTNGYGNYQIVCQPNQFRCSSGL
CIHESSRCNGKTECPSGDDEQLCPCQQSKRCIPWSQLCDGKIQCLLGDDENQTNCKLPIN
NETNVTEPPIYQPTTYDYSNQGNSSNGGPGATVVKVNKVVQSADRTTNEFHPKKDDSGFL
FVNFGPIINGDNNVNGNGNDLGNGNENGNGNGNGNGNGNGNENGSGNNNHYQKFIPSGED
YKNYYTEGKAYYP
Download sequence
Identical sequences T1JS11
tetur01g08860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]