SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur01g14380 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur01g14380
Domain Number 1 Region: 10-167
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-39
Family Phosphotyrosine-binding domain (PTB) 0.0000179
Further Details:      
 
Domain Number 2 Region: 402-502
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-23
Family SH2 domain 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur01g14380
Sequence length 507
Comment length:508 (n/a) (PREDICTED: similar to shc transforming protein)
Sequence
MMTSTSGVHDWRFFSLKYVGCLEIYTPMKSLDFDTRSKVAKECINRVCEASGLKTVDKKR
RPDKRIFKMLAERPNMDNAGSNVNLEITSSYLKLSVMETGEVIAKHDMPNISFASGGDAD
TLDFVAYVAKDHEFVRACFVLECGGGKAQDVISTIGHAFELRFKEFLAKQPHKSIQERFE
HRTQFNSLINHGTLEGAIGGDDRDYYNDMPGKVPPDLPERKNDRRIDDKFMRVHSLGRSS
VGKFNAQQPSTSDPTPNLIDLTSDLQVLPSEALTLNNAIASSFSSPLSKLKTTSANPSPC
SRTSSFNRKTEPEYVNCNPEELSKLNSSIKESSSSSLPFAIKDPFDMQPFCGALENLSTD
LEPSSLLSSTSPINGSSSSKLETSDSINDLKSSISSTTNTNEDLAQAVWFHGAIGRRESE
MLVVNDGDFLVRESLHSPGKYVLTGMQGGLRKHFTLVDPEGVVRTKACTFDSVTHLINYY
RDNQLPLMTADSELVLLNPIIRRSQAS
Download sequence
Identical sequences T1JTJ6
XP_015784894.1.93521 XP_015784905.1.93521 tetur01g14380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]