SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur01g16040 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur01g16040
Domain Number 1 Region: 325-416
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.49e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0008
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000586
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.033
Further Details:      
 
Domain Number 3 Region: 52-103
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000759
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur01g16040
Sequence length 780
Comment length:781 (trh) (Bm trachealess) (n/a) (trachealess)
Sequence
MDSHHFNPYHHPYYRVGATVKDHHHHHHHHHHQSVETVAQAAIVQSRILEMRKEKSRDAA
RSRRGKENHEFYELAKLLPLPAAITSQLDKASIIRLTISYLKLKDFSNNGDPNWSKLAPN
PNNPLKNNKMYNMFDVHQGTHILQSLDGFAFALGQDGRFLYISETVSIYLGLSQVEMTGS
SVFDYTHQQDHAELAEQLGITHTNSLSSSSSQLSSSPLPPASVGSNASSESDSPSYGNSN
NLMTTSDPDHLERRFCIRMKSTLTKRGCQHFKSSGYRVVHVISHLRPDANSRRETQNGPV
KLVGLVGIAIALPPPSVNELRLEPDMFVMRLGLDFKILHCEPRISDLLDYNADELTGRNM
YSLVHGQDVIQLRKCHLDLIHKGQVMSKYYKIMNKNGGFTWIQTCATLICSNNGTPNGKG
ATNGGSTNGSEDQEQSIISVNYVISGLEYDHVIMDLSQLGGIGLINSVSSSPITIKTSPS
SKRITPSPPSPLIVGPPPQSVPPSSSSSVSSSSPSSNNQTNQLTLNGNNGIIGSGVRRPM
PGDSCSSQQQHGLSNGNSPGHHAGVPTSSATAPSNSINGNQSSIDSSKRRRYTSSPVRPW
KSPSPPSSESPVSSIGGSNGLTSGGHGVLSPGSPGPCGSPSSNLLRHISVIRETPAILKP
QVVAPAAAYHHPHHPHHTHPHPHHTHHHQQTHPHGHPHTHPYHQSPPPPPPPPPPPPPHP
SHHYHHLVDPYAAAYHIYKTGGNPGPGVPTAATATPTPNKQKPKIDDTHGTKLRLQDISF
Download sequence
Identical sequences T1JU00
tetur01g16040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]