SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur02g09390 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur02g09390
Domain Number 1 Region: 8-191
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.21e-42
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000073
Further Details:      
 
Domain Number 2 Region: 193-300
Classification Level Classification E-value
Superfamily E set domains 7e-23
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur02g09390
Sequence length 512
Comment length:513 (NFAT) (Rel domain protein)
Sequence
MTRFAGNYPSRSRNGKIELRILNQPEEQHRARYLTEGSRGSIKDGTGLGHPVVKLFGFNG
CPVKLQCFIGHDKYIGVPHLFYQASRITGKNSTRCSYNKVDGTAVITLDLTPENNMQATV
DCIGILKERNVDVEQKVLKLKSANGIQDDGPAIPLPSKKRCAKCRLVFRCRIPGTNEVLQ
AVSTPILCTQPVGTPEICKISLNECKVTGGSELYIIGKNFLKDSKVIFKSDNWGKVVEPD
KEYLHSSHLVCTVPPYDGPNADLPGYFTVSIRIRSGGKYSDSHIFTYVNESKANSMLLRS
LPLNHSNNMSHHQQQQAQIQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQLQAQVQVQVQ
TPTPVQVQIQAQAQAQAQAQAQAQAQAHAQVQAQQQQQQQHGSLTGTLGSNHYGELISDQ
QTTFFTPFGGSHGDPILNGIKQEEVPTMCRIDRVNHINSTPKTIINAPVMAMDNAVRFYS
EDTFHSSDSSTISEPILASEDITEFLSLFTQF
Download sequence
Identical sequences T1JWT0
tetur02g09390 XP_015795101.1.93521 XP_015795102.1.93521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]