SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur08g02750 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur08g02750
Domain Number 1 Region: 45-166
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-28
Family Pleckstrin-homology domain (PH domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 230-335
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-24
Family SH2 domain 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tetur08g02750
Sequence length 463
Comment length:464 (SH2B2) (SH2B adapter protein 2 homologue) (n/a) (unnamed protein product)
Sequence
MAHFFRGISRYLSGIFHKKFSDEVDFSSERRESTNRNGNSIRNNRTLNEDSSIVNEGVVD
FISVDPSMIDIKLKWEKCRLSLISTSAGYNLQFYSPPKSVKPKCELLCSSIIEARETTVL
EMPDQDYTFVLKAESGLEYVIEASSASELKDWLNIIHACMQCNNSENIDLNNIELSETNI
RNGSLHRRRLNSVSNTNNENNTNGHASSPNASQPGTPLTGGNDISLFLSQYPWYHGLLTR
TDAAEYVLREGSLGHGIFLVRQSETRKGEYVLTFNFHGRAKHLRLTINGEGQCRVQHLWF
RNVFDMLDHFRVHSIPLELGGTADVTLTDFVIYQPYSPPSSTHDSTNLTDLHNHHHINHQ
NSSHPHQPSQSHNITNNSNPLQQQSRSSTPNSNFEPSSSSPDSRHNYLRERVPSIPEIQE
VITYGGSVRLRTVSLENLNQLQSQHLASVNGTTRAIDNTYSFI
Download sequence
Identical sequences T1KB40
tetur08g02750 XP_015785253.1.93521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]