SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur14g00700 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur14g00700
Domain Number 1 Region: 30-144
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-30
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 208-276,313-341
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.29e-17
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00052
Further Details:      
 
Weak hits

Sequence:  tetur14g00700
Domain Number - Region: 368-378
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0016
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 410-499
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0706
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur14g00700
Sequence length 511
Comment length:512 (n/a) (Wiskott-Aldrich syndrome)
Sequence
MSIDNVNSGQRKPSQNKGSMLLSKEENDLVFSLLGEKCVTLSSAVIQLLVTTPPTHSKWT
KHTTGVVCFVKDNIVRSYFIKVYDIDNKRQCVWQQELYRYFDYKAARINFHTFEADSCRA
GLYFADSNEANDFLNIVESKVKILEKRGKNSKQQSNSSYPSITGPASDPFASHTPIASKK
KEKGKKEKDKKKKENKPKVRKEDIGLPTDFQHLRHIGWTPETGFNVTNITPEYKKFFEFA
GVTEKQLQLPNIRSFLYDFVDKRGGIQVCLQDMDQHLSQKQPPSLPLQLQSQSWNAPPTG
VPPPLPTRTPHHRTQAPPPPPPMNPPVTKPPHSAPPPPPPPPPPASLGAMAPPPPPPPPP
PPSGGSGPPPPPPPPPPPASGPMMNNAPRSVGDENRSLNANGGGGLDARSALMDAIRNGP
KLNRVDQESLSSKSNSSGDTGRDALLSEIRKGTQLKPVGTTALERPAVQARPIGGIAGAL
AKALEERQRALQGTSDESDASSDTPSDDEWE
Download sequence
Identical sequences T1KL08
tetur14g00700 XP_015788141.1.93521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]