SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur14g02640 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur14g02640
Domain Number 1 Region: 292-498
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-44
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 657-700,739-884
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-23
Family Pleckstrin-homology domain (PH domain) 0.00042
Further Details:      
 
Domain Number 3 Region: 490-609
Classification Level Classification E-value
Superfamily PH domain-like 7.19e-19
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur14g02640
Sequence length 890
Comment length:891 (n/a) (unnamed protein product)
Sequence
MSSLTSEGTSETNCSNGDKSDTCCPSMSQKSDNKPSLRPKPLLTLNNNNNIIIDGDNLTH
QSDLLDSLSSSPSHRHQICVTSTSSISVSKTTNTQQRLPCRPAPGPPSTRSSISSVISST
GSLNGVDGELRRSITPRATTPKPPVPVKPAHLRNLRFASPSPPATLKKSNSKENESTGIK
QSSHLDKSCSPKCTTQLKCLPEKASPPQSRKIKEQQEDSLSDNISISPELRRKSSSVNGT
IGSFLHPHSTIDTPISSEEEFSDSRSIGSTNSIIIATNTEIDGGEKNINPEEEMKKRQER
KLFLVAQELTKTEEDFVNNMVLLLDFREHIRNSIPEEIINSIFRYVPELHEYHKQLAEEF
RNRINKWESNPKIADVLIIMGPFLKPHAPYTKEFTSMVTTLEEATKKYPGFADALKEFEK
TDRCNKLLVRHYMHKPVQRLPQYKLILEKYQTYLTEDHPDYKDTLAAIELVSKIADFAND
FVRKGDSSSKLLKIQTSLVRSYEIIKPGRVLLKDGELDKLSRHEPQPRLFLLCNDCLIYL
TALQQGTVYKLNHELSLEGMRVQVPDHQQFQNEFSIISPSRSISVAAKTPAECASWIEAI
KKAIKDYETRRNTFNTSSHGDRVGDQVLLGFEAPLWIPDTRVTMCQICSAEFTVTFRRHH
CRACGKVVCNDCSSNKAPLRYLKFRAARVCDQCFPVLQDQMTKKLTISMTTALRDHGASS
DEVNDDLVDDSGSVNSNGATSTGSTVTPSNFDLDNLKAQFVRIPLGLRSSGRRKSLPQRL
KEVSADDKNCSISGYLMYKKNYKKSWKKAWFVVKEKVLYRFKESNDTAALQSLPILGYQV
QLVTDGSIDSSEAGLIFQLSHPGQNTILFKTLNQESASRWIQEILSNTQL
Download sequence
Identical sequences T1KLJ3
tetur14g02640 XP_015788100.1.93521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]