SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur22g01640 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur22g01640
Domain Number 1 Region: 221-491
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.79e-51
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 739-1054
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.28e-50
Family Ankyrin repeat 0.0000253
Further Details:      
 
Domain Number 3 Region: 412-691
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.36e-45
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 4 Region: 48-160
Classification Level Classification E-value
Superfamily POZ domain 9.81e-19
Family BTB/POZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 1079-1138
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.34e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur22g01640
Sequence length 1144
Comment length:1145 (n/a) (PREDICTED: ankyrin repeat and FYVE domain containing 1)
Sequence
MERGEVEKLREHLSLLREQYVKLQSKNSEIERKYNVLVASAGETNENHFVNRLMKTIANL
LDKEDYSDCTILLNGGEIKAHKFILSSRSDHWGVEDLNEISTLDWKDIPYDTGLVILKWI
YTDQIDLTSNIEETILTIIKIAKRFHLSSLVEKCEESLMSFVNVRNCVKFYQIADEIQAD
VLKNHCSQLISNYWNDFGSDDFAHMSASLLFNMFKAKTRFPLHQAIKIKREDVVFLYLIE
YDSQLFTKINEFDESGEIPLNLALKTGQLSIAKTLLRHQANINAVDDNSRTLLHRAIERD
DGESINFLIESSASVHIATSKEKLTPLHLVCSKKLSDPTISTKLLAAGSDPNLQDAEGNT
CLHLAILHDNEIVFNELLEYRNISLDTRNAKGFTPLTLALSQLESNDIFAIKLVEKGASV
DSSDPSSGNSLLHIAASEKNESAGIFLINHGAKINVTNKKGEAPLHIAASLGLERLVKTL
LENGANCNIVTSSTTVNSSDPFASPTERISSDELQVFNQTPLHLTVLNKHENIIRIILSC
KASDGKDLGSSITLPNLNIKDSNDETPLSIAIRLKLLDIAQLLIDEGANVNIKDSTGYTL
LHKAIINEDSRGALFLLNHGADINLSTPNGETPLQLVVKHQLESVLIDLCSKGADVNTLD
ENGNSPLWIALENKNEDIASILVQYECDTNCWGEGPGGCWQTILHRSLDENNEFIAVFLI
RSGCDLNSPRKPSPDGKGDEEAHDGQTPLHMACAWGLENVVQTLLEFGASVNIQDADGKT
PLHIAIFNQHSTIISLLLCHPSLNLNLRDRNGCTPFATAMSIKNNKAAQEILNRDPNSAE
KYDAKGYNFLHTAIKRGDIESVLFLLSINVNIHSRVQDPVQMTPLHLSVECGSELILRNL
LLAGVNINDVTAQKQTALHIAAEHDHSVIASILLEKGIDFNVADINLNNALHIACQKGHL
ATVKVLMNESTIQSDACNAKGQTPLHLVAQFGRDNAAAIFEHFIACEPEYPINKPDAEGN
TALLLAYINGNVNLCRALVKNRACLGTSNKSGTNLFNCQVASNSLLYKLLDSLDAEPVWT
EGNDCSECSRKFSIQYRKHHCRHCGRILCSNCSAKMITIPKFNLNRSVRVCEICFDVLMM
GFSA
Download sequence
Identical sequences T1KUX6
tetur22g01640 XP_015790666.1.93521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]