SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur37g00680 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur37g00680
Domain Number 1 Region: 210-479
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.62e-67
Family Eukaryotic proteases 0.00058
Further Details:      
 
Domain Number 2 Region: 56-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000301
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Weak hits

Sequence:  tetur37g00680
Domain Number - Region: 171-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000119
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur37g00680
Sequence length 480
Comment length:481 (SP49/M) (Serine protease, multidomain) (SP49) (Serine protease)
Sequence
MKGNIKLSLILFTLIWFPNSGEDQVERFNFKRDFTANTDLACSIGKEPYVFTEDYPVGRI
ISPGYNVEAFYTKNVFCKWLIKAPPGKVILISIERYSFGLDDEGSAKLIIYDGPEEKQLA
VATRRFNLSKIFTSKTNQVKIVFNGAERGKGFEFYYKHIDPPQECSLTLDKQCRNKFQCY
SKSDICDSKNSCIDGTDEEDCVRNEHDLSFPEQCGTPVIPPSILGAHIYGGEKVIPGSWP
WLVSLRYPKSAPVDHVCGGVLLNRLWVVTAAHCLLFGNTKLFEVDFGRFNSMIDTSGKEV
KRYIDQYFTHPSFMADGTVPENGNFTKFDIALIKLNAPVPIDNDYIKPICLPESGLVIEE
NSSAFVVGWGNPSKIDTEELFLKQAGVPVISLDRCKKQHPYDADTLGEHVICAGKLEGGT
DSCEGDSGGPLMNYNAAKKQWQLIGTVMSGEKNCGEEGKAGAYAYVPYYRNWIDQTIRNN
Download sequence
Identical sequences T1L439
XP_015793591.1.93521 tetur37g00680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]