SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur37g00870 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur37g00870
Domain Number 1 Region: 23-149
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.05e-53
Family N-terminal domain of cbl (N-cbl) 0.00000264
Further Details:      
 
Domain Number 2 Region: 237-323
Classification Level Classification E-value
Superfamily SH2 domain 1.39e-47
Family SH2 domain 0.0000059
Further Details:      
 
Domain Number 3 Region: 329-407
Classification Level Classification E-value
Superfamily RING/U-box 1.08e-41
Family RING finger domain, C3HC4 0.0000173
Further Details:      
 
Domain Number 4 Region: 152-236
Classification Level Classification E-value
Superfamily EF-hand 3.4e-37
Family EF-hand modules in multidomain proteins 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur37g00870
Sequence length 454
Comment length:455 (Cbl) (Cbl) (Cbl) (Cbl, Cas-Br-M, Casitas B-lineage) (n/a) (PREDICTED: similar to Cas-Br-M)
Sequence
MTSLLNKIQGAFSEAISQSPKLVIDKRTVEKTWKLMNKVVKLCNNPKIILKNSPPFILDI
LPDTYQHLRLIYNKYEDRMNYLNENEYFRVYIDNLNKKCKETIRLFKEGKDAMFDETGPC
RRNLTKQSLVFSHMLSELKAIFPDGLFAGSNYRITKSDAAEFWKNHFGDRTIVPWRIFRQ
TLHQEHPIGSGLEAMALKSTIDLTCNDYISNFEFDVFTRLFQPWSTLLRNWQILAVTHPG
YVAFLTYDEVKARLQKYINKPGSYVFRLSCTRLGQWAIGYVTPEGNILQTIPQNKSLCQA
LLDGYREGFYLYPDGRNVNPDLSWAVQATPEDHIRVTQEQYELYCEMGSTFQLCKICAEN
NKDIRIEPCGHLLCTPCLTSWQDSEGQGCPFCRAEIKGTELIVVDPFDPNPRSATKEANR
DQNLVDIEEDENFEKKYVSSYLRFTLEKNRIKMN
Download sequence
Identical sequences T1L458
tetur37g00870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]