SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414077061|ref|YP_006996379.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414077061|ref|YP_006996379.1|
Domain Number 1 Region: 289-626
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.94e-50
Family Patatin 0.0000309
Further Details:      
 
Domain Number 2 Region: 9-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.02e-30
Family Laminin G-like module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|414077061|ref|YP_006996379.1|
Sequence length 636
Comment patatin-like protein [Anabaena sp. 90]
Sequence
MTNQVNTQSVLTFDGQDDYINFGKNDIGGVFAQGSSAFTISGWVNPHQLTNKATTYGAHN
VFFARSSDRYSDNFEFGISEEGNLDVYIDENIDNVIKTFGNGELTIGQWHFFAIVFNGGQ
LTIYLDDHEYTGSLTGSSLNKATSPITMGATLHNNVYFTGQLANISVWNYPCTQDQIQTH
RSSPLVGNEPGLVAYWRLNEGEGTTVQDQSGNTHNGTLYGDPSWNLAQVLFAIAQSSSEG
HRPSSSPAEIAEIAQTTEYPIPDNIQQQEQAQTPSQEESKQTMNNTANPKYKILAIDGGG
IRGIIPAIILTEIEKRTQKQIFSLFDLIAGSSSGGILALGLTKPRLDLAGSDSPPVAQYS
AEELLQIYLEYGAEIFYEPFWEQLLGQLEDIFVQPKYSSEGREEIIKQYFGDSPLENNLK
EVFVTSYDIEQRIPIFFTNKLEKQQTKSKKFRKLCLGFTLTDAALATSATPTYFAPYRVS
SSHNTNGFYTLVDGGLVANNPANLAILEAQISRQENQQALNMEDILVVSLGTGSLTSVYP
YDQVKNWGLLQWTKPLLNMVLDGGSEVVAGELERLFEATNKGHKTSYYRFQPFLKSELED
IDNAKPENLRQLQTLANILIQEKNQEIDELCSILSS
Download sequence
Identical sequences K7WVG9
gi|414077061|ref|YP_006996379.1| WP_015079728.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]