SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414077085|ref|YP_006996403.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414077085|ref|YP_006996403.1|
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily Cadherin-like 1.15e-28
Family Dystroglycan, N-terminal domain 0.047
Further Details:      
 
Domain Number 2 Region: 390-470
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Dystroglycan, N-terminal domain 0.054
Further Details:      
 
Domain Number 3 Region: 146-400
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.17e-16
Family Acetylhydrolase 0.071
Further Details:      
 
Domain Number 4 Region: 475-673
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000916
Family Serralysin-like metalloprotease, C-terminal domain 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|414077085|ref|YP_006996403.1|
Domain Number - Region: 108-147
Classification Level Classification E-value
Superfamily Cadherin-like 0.00138
Family Cadherin 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414077085|ref|YP_006996403.1|
Sequence length 683
Comment hypothetical protein ANA_C11832 [Anabaena sp. 90]
Sequence
MAVVNNAPIVANLIADQNAKQGTAFNFQIPTNTFTDIDAGDILTYSATLENGNALPNWLT
FNSTTRTFSGTPTNDNVGNLNVKVAATDKTGASVNDTFTIKVQNVNTAPILKNPLLDQTV
KVNSTFTFTLPKDTFSDPDAVNPYKNLVIFGDSLSDTGNAYKASGNTFPPSPNYQGRLSN
GLIWVDYFAPDLQFTNQSIQNYAFLGANTGVSNTFGQITVPGLLTQIQQFKTVNANSIGK
DGLYVIWTGANDFLNLATDPTQAVTNAVTNISSAITTLAGLGAKEIVVGNLSDLGATPLS
IANNNVANARAISIGFNAALTQALTNLEPALNVDLSLVDIFGLSTAFQTNPANYKFTNIT
QPLITVTTPVNPDQYAFWDDVHPTTRLHQLVTDTFENTLLKDGVIPDLIKYSATLADGSN
LPDWLNFNSTTRTFSGTPNTGNVGKLDVKVIATDKAGATVNDIFTLAVNQSTTVGTPGDD
KLIATPGSQFDGQNNIVFTGAGKDELDLSTVSVFPNSGSNIVDLGSGDDTIFVNKSDRAF
GSDGNDTFDARDGQGNNRISGGVGDDTFYLGSNDRALGGDGKDIFRVSLGGGNLISGGAG
TDQFWIVKAELPKAANTVLDFQLGTDVIGISGAVSLGITTSTLKLNQVGADTAIVFNNQT
LATLTGIQASSLSLTDPKQFVFA
Download sequence
Identical sequences K7VWR6
gi|414077085|ref|YP_006996403.1| WP_015079752.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]