SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414077537|ref|YP_006996855.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414077537|ref|YP_006996855.1|
Domain Number 1 Region: 1222-1414
Classification Level Classification E-value
Superfamily beta-Roll 5.36e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.00049
Further Details:      
 
Domain Number 2 Region: 1041-1215
Classification Level Classification E-value
Superfamily beta-Roll 4.06e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0006
Further Details:      
 
Domain Number 3 Region: 651-934
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.00000000000000719
Family Putative isomerase YbhE 0.022
Further Details:      
 
Domain Number 4 Region: 352-576
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000000369
Family YVTN repeat 0.0049
Further Details:      
 
Domain Number 5 Region: 951-1038
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000571
Family Cadherin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|414077537|ref|YP_006996855.1|
Sequence length 1445
Comment cadherin family protein [Anabaena sp. 90]
Sequence
MLNNSFLRQTATTIVFIDASVSDYQTLQTGIIEGVKSVIISPNQDGIEQISQILQQHPHI
TTIHILSHGAPGCLYLGNSQLNLTNIHNYTQQLQHWQRQNILLYGCNVAAGDAGEEFIRK
LHEITNATISASATKTGNAALGGNWELEVNIPEKKGKSPVFGADTLARYQGIFASPFATI
LTAVYGQLTAFAGLESFWQRFDEAFGSQYNRVLAESFLSQWQMGDFSQFPTIEVVSSDVL
GSANGAYAISTNKIYLSGQFVTTASQQSLLAVILEEYGHFVDAHINTSDSAGDEGELFSA
LVRGVNLTASDLARIQAENDYAVISIDGQSITVEQAATLVGKWDRLTIANAIAIVGNYAY
VVGDNLEVIDISNLSSPVFVGTYEFTVTQDSAGYYAKDVQIVGNYAYVAASGFGLQILDI
SNPTNPTLTGTYNTSGSASAVQVIGNYAYIADGQSGLQIIDITNPSNPTLKGTYNTSGSA
SAVQVIGNHAYVADEQSGLQIIDISNPTAPTLKGSYDTPDLAWGLQVAGNYAYVGDWRSG
LQIIDISNPALPLLKATYKPDDFFWVKNINVSGNYAYTRGQVIDISNPLNPIKKGDYASS
WPDGIDVSGNNLYNAGSGTGLNIFDISNPDFPVKKGFYDTSSGESVTVWVSNNYAYVGKN
SSGVQIFDISNPSSPALKSHYGSYNSTPNVSFSAKDVEVVGSYAYIASWDQGLKILDISN
PNNPISKATLAIPGQYYGTTALRVIGNYAYVTNINSGLSIIDITNPTAPTIKGNYAGEGY
DVQIIGNYAYIANGYSGLQIVNISNPTTPTLISNFLGSGSYRQRGIEVVGNYAYVASETQ
GLLIIDISNPSAPTLKGTYNTPGDATRVSVVGNYAYVADGMYGLQIINISNPTNPTLAGN
YDTSGSVADVRVIGDYAYVADGDGGLKIIDVSTFTNPSINQAPTDLTLSNSAITENLAVG
TAIGSFTSTDPDTGNTFTYSLVTGTGATDNSLFSITNNQLTTNTVFDYETQNSYNIRVRT
TDQGGLFFERQLTIGVTDLNDNESFTTTAQQDIIDADYGDDTITSTFANLQQNDTIKGGN
GTDTLIITGGTVNDIISIDTSNTTNQLDIPGTTVFGFERFDLTSFTGTVSFDGTTGNDWV
KGGTGNDDLSGGDGNDYLNGGTGTDFLIGGKGNDTFVVDNIGDIIAEGLNSGIDTVESSI
TWTLKTNLENLTLTGTTAINGTGNTLNNIITGNAADNVLTGGTGADTLIGGAGNDSYYVD
NTADSITENLNQGTDTVFSSVTYTLTTNVENLTLQGTTAINGTGNDLNNSITGNTAANVL
TGGLGNDTLTGNAGADTLIGGFGNDSLYLGLNDNAVDNVNYVLGDATDTVYQFVRGVGGD
KLNFTGIANFDVITSGTSTLVRVGDGIGGNTGFGTGQLLVTLSGTSGFTSANANLNLFGG
NFLFN
Download sequence
Identical sequences K7W1Z3
gi|414077537|ref|YP_006996855.1| WP_015080199.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]