SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414077743|ref|YP_006997061.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|414077743|ref|YP_006997061.1|
Domain Number - Region: 305-343
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00288
Family TolA 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|414077743|ref|YP_006997061.1|
Sequence length 475
Comment hypothetical protein ANA_C12527 [Anabaena sp. 90]
Sequence
MSYVSLLKNIPEIFSQPTGIAAIASLGIHGAIALIVPLMPVNSGQSSKTDSPKAVGLMEL
STADQSRLPQPPSTSPVALQQPQLPLQQQLPGANLSSPLTNYPALQPELSSQSVLPAIPS
SPTNLNLSYLPSKQSIERLTRNDLQIAMSRLPRSTYTPSTSSTSPFVNNLDQRMKETGSL
GINRLPELRQSHEIPGEPLNNPSAEAIDIGSTTTAGISPPQTVASGNNAVKIPQGGEKLA
LTDNSRGQSPEIITNESESKGKKTEQLLAKLNSYNTLRQNIRQEYPNVKEKGVIRETIST
DTPEMEGTVVGRLVVDPDGKVLDIKFQAGTESPKLQSKAREFFSANPPQADKQLISSYPF
QLKFQNNPNSAGVSSKTQPTATSNTEKVFESKIQPTATPNSQKLPELQIQPTATPNSQKL
PEPENTKNRPETPSVNTSNSVTSEKSSSNSPAVSTESNQKLIQTLRQIKEERKNP
Download sequence
Identical sequences K7WI86
WP_015080404.1.50365 gi|414077743|ref|YP_006997061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]