SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414077873|ref|YP_006997191.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414077873|ref|YP_006997191.1|
Domain Number 1 Region: 286-400
Classification Level Classification E-value
Superfamily CalX-like 3.01e-30
Family CalX-beta domain 0.00056
Further Details:      
 
Domain Number 2 Region: 1466-1517
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000108
Family Type I dockerin domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|414077873|ref|YP_006997191.1|
Sequence length 1525
Comment calx-beta domain-containing protein [Anabaena sp. 90]
Sequence
MMESTGLNALFNETGKIYLSVDGRGTFDSTGSVRVDKKPGATVRKAYLVADGTNITSSVI
GTTAGINGTSINWDRTESTTVSSSFSFYSYLSDVTSLVKPTIDAAADGIISIAVDEGNES
ASYEGLALAVLFDDPSQPADSSVILYFGGLRPTGATSTINFSSPVDTSLTLAATLGLGIG
FSYAAGGQTSQVKVNGQPLTQVAGNYDDGQLGNGALFTVGGIGDSPDNPPPYSTDPATDD
ELYNLLPFINNGDTSLTLETVNPSNDDHIFFAHLTLNGISAVNIPSTITFSTTNYSVQED
GTPITQVTLTRSGGIIGEVSVTLTPSDGTATAGSDYDNNPITVTFGDGETTKTVAIAVID
DTIYEGDKTVNLTLSDPTGGAILGNQINSTLTIVENEPVTQSLYTFTYTYGNGDSYSGYG
YAAQGTYTVGQVLDGYTNETGNPGYYTIDSVDNAGTGNNNYVYVTSYTDGDTGYGTTNSI
NSWGYSGLGSEYGYAYNANYSGDTLFNSYYEADLPAVLQVRLNLLADNNGIAGEIISNDQ
VGLNRSFFVEIQVGDLRGNAAGVNGLGLNLAWDGLILESIDTPFDPTNIITANFPLLQDG
TLDNSSGLINNLSGGSLPAFELGQAIGVNQLERFALLRFQTENSTGTYYFTTTVDSAALA
DDNPYYSLDVETSQPIFIGSVYNQYNFTYNYGNLDSYTGYVYAVEGTYTPGQTIGNIDNE
TGNYGYYTIDSIASTTLDSYYNGYVYVTSYTDGDTGYGTTTNISGYGYSGLGSEYGYAYD
ASGNSSDPYFSQYYEADILGNQKYNFTYSYDNGDSYSGYGYAAVGTYTAGQVLGGYANET
GNTGYYIIDAVTSGTTDSSFNNLVYVTSYTDGDTGFGAAGYLSSGTGYYGLGSEYGYAYD
ANGNSSDPYFSQYYEADILGNQKYNFTYSYGNGDSYSGYGYAAVGTYTAGQTIGGIANET
NETNLYPGGTGAVENNTLGYNWVGDSVYHLSYTFTNVSDALTLNFIGSGLQEITDESWGL
DNVKVTAGGFNYSNDFESDSVTGWSSSTRSTTPVGSRNFLGEFGNDTVSLALNDVALNGS
VTVEFDLFIINSWDGNGSFAAGPDEFTVNTSDGQTLLNTTFAKYPGQLQSYPGAGQSGQY
TIDSVELGNTNAGYNGYVYVTSYTDGDTGYGTTTNLYNYGGYYGLGSEYGYAYDANGYSS
DPYFSQYYEADIQNQLFNYTYTYGNGDSYSGYGYAAAGTYTAGQVLDGYANETGNTGYYT
IDSVSAGTTDSSYNNRVYVTSYTDGDTGYGETTNLYSYDGGSGLGSEYGYAYTADGYSYD
SYFSPYSEADLVIPGLAITDNSGNANDSSIKFTTELSKFRKNFQDSDYVRPNYADTTKYF
DITNTGSGVLVVSDIQINVSGVTVNLDLSGDKDLFLNAGSSQRVNLTYDPLVAGENFDLT
NGLVLFTNIPNWSQYEVALSGKSTFNSDINYDGKVNTGDLGSLNQAKTNFDNGIFDATAD
ITGDGFINTLDASALIADIKLKLSV
Download sequence
Identical sequences K7WII0
gi|414077873|ref|YP_006997191.1| WP_015080533.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]