SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414078848|ref|YP_006998166.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414078848|ref|YP_006998166.1|
Domain Number 1 Region: 34-328
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.06e-61
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414078848|ref|YP_006998166.1|
Sequence length 339
Comment photosystem II stability/assembly factor, HCF136 type [Anabaena sp. 90]
Sequence
MQSILKKWQSFVAALIVVIACIGCSSVPSISNNPWQVINVPTKSKLLDISFANNSQHGYL
VGGNATLLETKDGGDTWQPLKLELDDPRYRFNSVSFSGQEGWIAGEPSLLLHTTDEGKSW
SRIALSEKLPGSPIAITAIGQNTAEMATDIGAIYQTTDGGQNWKANLDAAVGVVRTLERS
PDGKYIAVSAKGSFYSTWEPGQNAWQPHNRNSSRRLENMGFTNDGQLWLLARGGQIQFSD
PTKPEEWLEVEYPELSTSWGLLDLAYRTPDEIWIGGGSGNLLRSTDGGKTWEKDRDVETV
AANLYKIVFFSPDQGFIIGDRGVLLKYNPKTAATAAPAA
Download sequence
Identical sequences K7WL78
gi|414078848|ref|YP_006998166.1| WP_015081484.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]