SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414078883|ref|YP_006998201.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|414078883|ref|YP_006998201.1|
Domain Number - Region: 215-259
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00107
Family Di-heme elbow motif 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|414078883|ref|YP_006998201.1|
Sequence length 283
Comment hypothetical protein ANA_C13735 [Anabaena sp. 90]
Sequence
MSIYNNRVAILATMHNKEKVISPLLKEHLGINLIVPQGLNTDVFGTFTREIKRPDTQIIT
ARLKAKKALEMDDEKIAIASEGSFAPHPLIPYIYANREIIIFLDQENDLEIIGELFSIET
NFNHQTISSLEEAEEFAQKVGFPEHGLVISFANISTGKTESIKGITSQENLINSVETAIK
NTNGKFHIETDMRAMYNPTRMKNIAFATQDLINKINSLCPQCNTPGFMINQKIPGLPCEL
CHQPTSLIKAVIFQCQKCGFTQQQLFPNNQEFADPSLCEYCNP
Download sequence
Identical sequences K7WLA0
gi|414078883|ref|YP_006998201.1| WP_015081519.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]