SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414078930|ref|YP_006998248.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414078930|ref|YP_006998248.1|
Domain Number 1 Region: 1535-1703
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-37
Family Laminin G-like module 0.061
Further Details:      
 
Domain Number 2 Region: 823-1087
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.79e-33
Family Integrin alpha N-terminal domain 0.025
Further Details:      
 
Domain Number 3 Region: 2042-2220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.94e-32
Family Clostridium neurotoxins, the second last domain 0.044
Further Details:      
 
Domain Number 4 Region: 403-547
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000034
Family Galactose-binding domain 0.059
Further Details:      
 
Domain Number 5 Region: 1889-2010
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000101
Family Galactose-binding domain 0.08
Further Details:      
 
Domain Number 6 Region: 1290-1421
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000851
Family Galactose-binding domain 0.087
Further Details:      
 
Domain Number 7 Region: 1091-1179
Classification Level Classification E-value
Superfamily CalX-like 0.0000000484
Family CalX-beta domain 0.009
Further Details:      
 
Domain Number 8 Region: 144-276
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000562
Family Collagen-binding domain 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|414078930|ref|YP_006998248.1|
Domain Number - Region: 549-606
Classification Level Classification E-value
Superfamily CalX-like 0.00106
Family CalX-beta domain 0.011
Further Details:      
 
Domain Number - Region: 762-819
Classification Level Classification E-value
Superfamily CalX-like 0.00209
Family CalX-beta domain 0.019
Further Details:      
 
Domain Number - Region: 360-409
Classification Level Classification E-value
Superfamily CalX-like 0.00458
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number - Region: 1804-1875
Classification Level Classification E-value
Superfamily CalX-like 0.0811
Family CalX-beta domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|414078930|ref|YP_006998248.1|
Sequence length 4414
Comment galactose-binding domain-containing concanavalin A-like glucanase [Anabaena sp. 90]
Sequence
MALPDAIKENAENLRIDIQPYYFDLDVTNNKDISNFRLKQNGQIVNNITADITIEDSGLY
QSQVFIVDQNDQLVNTNNPLVIRDGKSVFKVKLGSQPTKDVTVQFNQPTSGNLDYNQIQF
QYQASKGSSLISGSRSLTEGSTGTIEPNDTSEKAIAITTTAFTFDGEISSDYSKTDVDLF
KIALRKGDTISIRVDARSTNPIISNLDSRLKLFNSQGVIVTEKDDDPGRSTDPSIEYTIT
SDDTYYIGVAYYSVDYGLTRINNSSQNSGKYKLSVNVIPNSNAPDPNSPIVNPWDQWQTI
TLNGVNSDFNLTASVSSTDGNYTKLNISVPVTTQIPLQNKVTEGAQLQDLGTPRLSLLAD
SSITENSDKPGQFRLQLSHAAKEDLTVSYTVSGTATLGSDYTGNLSTVNTRPANGQISAS
SSSLVSPVGEEKEKAFDNNTNTKWLISAKSAWIQYQLPNNNAAIFNSYIITSANDLPSRD
PQSWELLGSTDGITFEKIDQQSGIKFTNRFETKTFAINNTKAYQYYRLNITSNNGANELQ
LAEFNLYHRIIIPKGETVAILPIFPVSDSIKEQKENLTISLNSGNGYTIDSNNQSKALQI
IDSNIAGLEIANVSFNLQNLNAQGQPTPIIASSFRPLQTSENGDGESFAIRLQSKPSSDV
TVSFTGLNTTEGELKLYQGGTISPIVFTPDNWDQYQIITVVGKADTLVDSNITYQIQATP
SSADSNYNNTNLQQNITVTNQNIDSNTAINSSDITRPDPTLPVAKFSGNNATIAEEGGSQ
KVQITLDRPAPQGGLTVSFSVDGSTATLNQDFIVNTNIFQSQTGTANPFDQIDIGNFSTP
SFADLDKDGDLDLALGNADRTVKFYENIGSPGLPFFIEQTGSKNPFNSIDIGNNGTPTFA
DLDKDGDLDIIIGNSAGKISYYENITDSTGIKFGLRTSTNNPFDGIDVGDNSTPNFADLD
KDGDLDAVIGAADGTIKYYKNTGTPKQPTFSAQTGTSNPFNNIDIGDNSNPNIIDADNDG
DLDLFVGRKDGTISFYRNTGNATTPAFTLDNANSPSNTWKVQANSASVFADVNSDGDLDA
VIGAADGKLQYQEQVIIIPEGQTTAEITINSFGDQIKESNETINIRLNQRQGYRVDTEQP
ENVQKTITIQDNEKAGILLKNAQGQPISSLQFSTQENSNTPLTFTAQLTSKPTDKVQLYF
FSSNPGEGILTTTRNTTTITDSEIVLNFTPDNWNQPQSFSVVPQNDSVADGQVRYAITNR
VRSQDPTYNDTNDYQVSLGITDRLIELGKANNQLSVSDPNSPTTEQKEKAFDNDSATKWL
IFNKQGWLQAKFLDSAAVVNSYSLTSANDFPQRDPINWELLGSNDGENFEVLDRQSGVKF
NNRFETQTFTFDNGKSYSYYRLNILANGGANELQLAEFNLYVKDQLVIANNDDNDTQGFT
VTPLSSTTEGAGDAFSIKLNSQPVGKVVVTMTPGNEEFYFLGKNPGDTHSITFDPQNWNT
PQTIQITAVDDNKVEYLQKSLIAFQVSGEDPKYNSLSTTVNSFLQFDGIDDYIKVDRESD
FDFTDVITVEAWIKVDQFNKNWQSIVTKGDSSWRLARNNNTNSLEFAIGGGNTTNVVGGI
TNVNDGKLHHVAGVYDGAALSLYIDGQLDNQVQVSRTLPTNNYDVLIGENAEATGRQFAG
QISEVRIWNAARTQEQIQANMNKNKSLVGNEPGLKLYYNSASQQATPNQIFDSSGNNHNG
VFQNGVQWKTTNDIFFKPLEVIIKDNDVPTARIIPGKAGAEIYSTPGYFIIELDRDSNNL
PPDNTGIEVNYRIVGGTATLNADYQSINTSKVRVFGNQVLLPIVPIDDKRIEDLTFTINK
VTPGTTNNGKTTLTLDVSAKGVVASDNILITASSLSSPNGEQKESAADKNSQTKWLISNN
SGWIQYEFVNNPTLVSKYYITSANDFSGRDPVDWTLQGSNDGQNFVPLDTRANIKFANRF
EQQAFTVNNPQPYRYYRLNITKNNGGIELQLADFTLEQKNIIDVPTASIVELAGQKTGSV
KTPGRIDQFGQGWFSFDGNNDYVSLPSLTMGGDFTVEAWVRVNQHPQSNTGNVRARIIDF
GNGQGSDNIILNFDGATGRLRLETYNGSSYTEVTSDSQIPTGEWIHVAGVNDGKGNASLY
INGELVKSEAGQNIAQNISRSKNFIAQSNWSNEKYFNGDIAELRVWDTVRSHQQIKENIN
RFLTDQETDLKVYFSANTSNFNQPGTTTQIQGINGINGTLQNGAIWTVTTVNNPIDNNVL
NYKGQIQVEVDSSIANQITANSIARFPSETVTVELLPGDGYKLGDSKSSSLNIIDNDVPG
IRIVTGGNRAVAIEDDPFKTNDKDEIRYSQYELSLLSEPSAPVTLTLTSNTFIVDKDNNK
KKQLRFINVDIDPKDPTKKIIRPADFITLTFQPDNWYQLQTVNIQAIDDGIVEDDTNPSQ
PHEASIQYQITSRDPNYNNLPVADQIVGLADRVLDKTQTNEGIKAGLDTLQSTINNLELP
IIGSLEGRSPTLMADLGNLVSKQINQLEGDQLTSTKLEKILTDALSALGATGVNVTTKMT
DTDVYFAVNLRKEYNLFKLDLSSDLGVPALGIGFDTQGQLTGDFKYDVSLGFGINKLLGF
YLDPEKTKFNADVSLDLDDFKGKGNLGFLQVDFADDPKNPTKLGISFNIKLKDPQAGKNN
LQEATPAVTTIDVAASQVETTPADQITIPQTQTLPSVPTEKEAIQPLTDSQATLPEAPST
TVPGQDIEQIPVADKTLTETVGEKTVQYNQNLQTILATAPLTSTFSNISAQTIRTWLGKP
DTDVSAINQQLIAVLKNASPEVKVALQTLLKDATQIDIGLNDKQLQITYAGTIDVAKLRT
VVPGVKDLPLDELKLPVTKPRLTITNPGLENADYSFAADSLPKAELVTWLANKGKNLLPA
EVQTVLNELLKFGQNLDVVLASNQIQVTYQGSLDIAQLRGVIPGIKDLPLNGLTLPVEKP
SITITNPGSKSANYSFTAANLPKAQLVSWLSNQAKTLLPTQVQDIFNKFLALTANVDLVL
GKEQIQITAKGDLDIATVIKEIPGINELPLDDLSLPVKNPSITITNPQSKSANYAFVAES
LPKQQLADWVTKQGTVLLPEEVQNVLNKLLALTDKVDLVLGENQIEVAYQGNLDLATIIK
EIPGVNSLPLTGLTLNVNDPRLTITNPKSANPDYAFAADSLPKRQILDWLGNQAKSLLPL
EAQTILTQLLNSGLDRVDLVLGKKQMQITYKGDLQLDSFIKFIPGLSDLPLDGLNLPVTN
PSLTLINLDQGVNNIDYVFSVDRLPKDELTKWLREKAVSLLPQEVRNVLDNLLQVAENVD
LKLGKNQIQVAYLGNLELGAILKQIPGIQDLPLDTLKLPVTNPKLTIINPNSQDIDYSFV
VDNLPKQELIDWLVQQLPDNVKSILNTVSNAAQQVDVLFSDRQLQLGYKGNIDLAKIVKV
IPGIQELPNLDSLALPVANPRLTLSNLGTKNLKNIDYTFSSDSLPKAELVNWVKTTLLQQ
LPADVQSFLQKALDIVQNIDLKFGNNQIQIGYLGDLNLKTIIDQIGTQLGDFLSPLKGLN
LTLTNPSITITNPKQTPSLSFGVDNLPMNQVKTWLTEQVKTYVSDASVQNFLTGLLNEIA
QIDLVVGDAQTQITYLGTVDLAKALKTIPGLESFTPNNLTLPILNPSFTVTRTGKTRTFS
LSAESLPKQELTEWLGTEIKNQLPAEVRSIVDSLLAVADKMDVQLGSNQVQFNYQGALDL
ATIIKEIPGLKELPVNNLQLPVLNPRLAITNPGKNASYSFAADELPKTQLVTWIKQQLPT
DVQSVLDTITAQAQQLDVVVGNNQIQLTYNGAVDLVKVLGLIPGVKDLLPATTQPLNIIN
PSLTILNPGKNASFSFAADKLPKQELLDLISSQIPTEVKSVFNNLSENLDVIFGQGIIQV
NYRGDVDLMKIASLIPGVKELPLNGLKLNVTNPSFTLINKGKAAGATLATFDYVFAADKL
PTQDLINWAKNTTTDILPAEVKGVLDKLLNIAKDVNFTLGNGQMQIAYNGNLDIAQVIGL
IPGLQDVSFFKGLNLPVTNPSITIINPKPGTGLKTQYLLKSDRLPKEELAKWAKEKATEL
LPADVAKILGSLSAIAQGIDLEIGTNQIQLSFQGTVNLSNVLKEIPGVNELPIQSLDLPV
LNPSLTITNPGKNASYSFAAAQLPKEQLINWLKDQAKALIPSELLSIFNTLANIGQNLDV
RFGDSQLQVMYQGNLNLMDIIKGIRGDSDSFNVSDLTLNVQNPSITILNPGRNADFSFKA
DKLPVKQLKDWLTKKVVNSLPEVATNIIEGITGVVEDVNVLIDKNDIQVLYNGSLDILSI
LQKIPGSKMSLYPLLVHYQLSIQRSPSQKLQDNL
Download sequence
Identical sequences K7W1N0
WP_015081566.1.50365 gi|414078930|ref|YP_006998248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]