SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414079481|ref|YP_007000905.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414079481|ref|YP_007000905.1|
Domain Number 1 Region: 317-390
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 5.89e-16
Family TonB 0.023
Further Details:      
 
Weak hits

Sequence:  gi|414079481|ref|YP_007000905.1|
Domain Number - Region: 62-143
Classification Level Classification E-value
Superfamily BLRF2-like 0.0222
Family BLRF2-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414079481|ref|YP_007000905.1|
Sequence length 478
Comment TonB family protein [Anabaena sp. 90]
Sequence
MEFSSVTIEQREKEAEALKTFLFFSLIGSLVLHIGILALAINKFFLKFPEVREEPIEVTI
LETIPQEVNQLPVEIKSLAKTNSGGGGGNKGGGISTPTETALNMIKSSVAPITKQAQLKI
TTNLISKQSQTLTNREPAKILTPVQTNPIENTTPEPATTPPPVETKPIQKLDENANTLAS
TQPQVQTKPTKITPLKSETQPNASSNNIPSNSTASTQLPQNKNILGNLGDRSRNSLGTGN
GTGSGTGVGNGIGNSTGNGTGSGTGVGNGIGNSTGNGTGNGVGNESGNKPKPENTPIATA
PKPPIENSSKLNRADCIQCQIKYPDRARQRGIEGNAEVAIDTDSQGNVTRVRLVRSSGDS
ELDQAAQQAAQEWKLTPTAEGREGVRASVNFAIKGSQRHRKLQERQIQKQRATTKKTPEK
ATSTSTPIESPQYNQQKITPIITDIPSENTTKQKEESAPSESQQISPPASATTSPTES
Download sequence
Identical sequences K7WMN5
WP_015083403.1.50365 gi|414079481|ref|YP_007000905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]