SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414075573|ref|YP_006994891.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414075573|ref|YP_006994891.1|
Domain Number 1 Region: 233-398
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.1e-42
Family Histidine kinase 0.00084
Further Details:      
 
Domain Number 2 Region: 14-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.59e-30
Family KaiB-like 0.0012
Further Details:      
 
Domain Number 3 Region: 154-241
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000961
Family Homodimeric domain of signal transducing histidine kinase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|414075573|ref|YP_006994891.1|
Sequence length 401
Comment adaptive-response sensory kinase [Anabaena sp. 90]
Sequence
MLKQDVMQVSQDQPIYAEAPLQLLLFVDGRPQSRQEVQQIRVYLKELEAGYSFELQIIDV
GQQPYLAEHFKLVATPALVKIHPEPQQTIAGTNIIPQLKIWWPRWQHAVGTFLKLQADKQ
ECLDEKSQVISPKSTIHSVATSAEAIQLGDEIFRLKQEKERLQEQLLFKDRVIAILAHDL
RNPLTAAAIAIETLQSNYNPDTGGFQRLKSGLAIHLLKQARTQTKIIDRMIADLLQAGRG
DDTELPIVPQKLQLGEICLQVLEELSDRYIAKSQTVETDIPQDLPYVYADPERIRQVLVN
LLDNAIKYTPAGGIITVAGLHRTSQKVQFTIGDTGPGIPEENRDRIFENLFRLQRDQSTD
GYGIGLCLCQRIIRAHYGQIWVDSSPHGGAWFHFTMPVYPS
Download sequence
Identical sequences K7WCH2
gi|414075573|ref|YP_006994891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]