SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_2DL_F82F53782.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_2DL_F82F53782.1
Domain Number 1 Region: 7-64
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000663
Family 7-Fe ferredoxin 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_2DL_F82F53782.1
Sequence length 71
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_2DL_scaff_9900339:961:1756:1 gene:Traes_2DL_F82F53782 transcript:Traes_2DL_F82F53782.1 description:""
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDVCKAKQIASAPRTEDCVGCKRCESACPT
DFFKCPRLFRA
Download sequence
Identical sequences Traes_2DL_F82F53782.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]