SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_3AL_3713B7527.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3AL_3713B7527.1
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000000558
Family Pollen allergen PHL P 1 N-terminal domain 0.0038
Further Details:      
 
Domain Number 2 Region: 39-69
Classification Level Classification E-value
Superfamily PHL pollen allergen 0.00000589
Family PHL pollen allergen 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_3AL_3713B7527.1
Sequence length 70
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3AL_scaff_4262386:1:420:-1 gene:Traes_3AL_3713B7527 transcript:Traes_3AL_3713B7527.1 description:""
Sequence
MSGTALGAMAKPGMADKLRAGGVIRMQYKRVPCKYPGVNIAFRVDQGSNPFYFKTLIEFV
GDDGDLKAVA
Download sequence
Identical sequences Traes_3AL_3713B7527.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]