SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_3B_90D3E8AF4.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3B_90D3E8AF4.1
Domain Number 1 Region: 6-64
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000741
Family 7-Fe ferredoxin 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_3B_90D3E8AF4.1
Sequence length 81
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3B_scaff_10546789:3534:3779:1 gene:Traes_3B_90D3E8AF4 transcript:Traes_3B_90D3E8AF4.1 description:""
Sequence
MSHSVKNYDTCIGCTQCVRACPTDVLEMIPWDRCKAKQIASAPRTEDCVGCKRCEFACPP
DFLSVCVYLGPETTRSMALPY
Download sequence
Identical sequences W5CZM5
Traes_3B_90D3E8AF4.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]