SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_4DL_7AA474747.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4DL_7AA474747.1
Domain Number 1 Region: 7-33
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000568
Family 7-Fe ferredoxin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_4DL_7AA474747.1
Sequence length 47
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4DL_scaff_14456289:147:287:1 gene:Traes_4DL_7AA474747 transcript:Traes_4DL_7AA474747.1 description:""
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTED
Download sequence
Identical sequences A0A218M0M5
Traes_4DL_7AA474747.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]