SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_5BL_68B8353B3.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Traes_5BL_68B8353B3.1
Domain Number - Region: 1-24
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000628
Family 7-Fe ferredoxin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_5BL_68B8353B3.1
Sequence length 33
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_5BL_scaff_8865978:2:226:1 gene:Traes_5BL_68B8353B3 transcript:Traes_5BL_68B8353B3.1 description:""
Sequence
VGCKRCESACPTDFLSVRVYLGPETTRSMALSY
Download sequence
Identical sequences A0A220IL31
Traes_5BL_68B8353B3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]