SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_5BL_F350FAA7B.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_5BL_F350FAA7B.1
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000568
Family 7-Fe ferredoxin 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_5BL_F350FAA7B.1
Sequence length 81
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_5BL_scaff_10808857:228:473:1 gene:Traes_5BL_F350FAA7B transcript:Traes_5BL_F350FAA7B.1 description:""
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPT
YFLSVRVYLGPETTHSMALSY
Download sequence
Identical sequences Traes_5BL_F350FAA7B.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]