SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_6DL_F4F20589A.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_6DL_F4F20589A.1
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 3.84e-49
Family Pollen allergen PHL P 1 N-terminal domain 0.0086
Further Details:      
 
Domain Number 2 Region: 117-209
Classification Level Classification E-value
Superfamily PHL pollen allergen 2.35e-33
Family PHL pollen allergen 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_6DL_F4F20589A.1
Sequence length 214
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_6DL_scaff_3273331:3240:5258:-1 gene:Traes_6DL_F4F20589A transcript:Traes_6DL_F4F20589A.1 description:""
Sequence
MGGACGYGNLYSTGYGSNTAALSTALFNNGLSCGACFEVRCDPGGTEAGAPHACLPGSTV
VTATNFCPPNFGESSDAGGWCNPPRAHFDMSQPVFQRIALYRAGIVPVSYRRVACQKKGG
IRFTINGHSYFNLVLVTNVGGPGDVHAVSVKSTRSAAWQSLSRNWGQNWQSNALLDGQGL
SFRVTAGNGQSVVSNNAVPRGWSFGQTFSGAQFH
Download sequence
Identical sequences Traes_6DL_F4F20589A.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]