SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_7AS_EDA7F0F82.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_7AS_EDA7F0F82.1
Domain Number 1 Region: 7-64
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000688
Family 7-Fe ferredoxin 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_7AS_EDA7F0F82.1
Sequence length 82
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7AS_scaff_4257303:7818:8063:1 gene:Traes_7AS_EDA7F0F82 transcript:Traes_7AS_EDA7F0F82.1 description:""
Sequence
MSHSVKIYDTCIGCTQCVQACPTDVLEMIPWDECITKQIASVPRIEDCVGCKRCESTCPT
DCVGARSVSYYTLFKGWLLLGK
Download sequence
Identical sequences Traes_7AS_EDA7F0F82.1 Traes_7AS_EDA7F0F821.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]