SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_7BS_EF1042AE9.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_7BS_EF1042AE9.1
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.68e-16
Family 7-Fe ferredoxin 0.0000815
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_7BS_EF1042AE9.1
Sequence length 80
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7BS_scaff_3013535:6:382:1 gene:Traes_7BS_EF1042AE9 transcript:Traes_7BS_EF1042AE9.1 description:""
Sequence
SHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTD
FLSVRVYLGPETTRSMALSY
Download sequence
Identical sequences A0A218LG23
Traes_7BS_EF1042AE9.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]