SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_7DS_3AFCA80A1.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_7DS_3AFCA80A1.1
Domain Number 1 Region: 9-33
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000247
Family 7-Fe ferredoxin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_7DS_3AFCA80A1.1
Sequence length 46
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7DS_scaff_3808488:21:295:1 gene:Traes_7DS_3AFCA80A1 transcript:Traes_7DS_3AFCA80A1.1 description:""
Sequence
AKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGPETTRSMALSY
Download sequence
Identical sequences A0A220IJ42
Traes_7DS_3AFCA80A1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]