SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_2BL_B304E8577.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_2BL_B304E8577.1
Domain Number 1 Region: 162-239
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000577
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 2 Region: 271-302
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000602
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 95-125
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000353
Family CCCH zinc finger 0.0023
Further Details:      
 
Domain Number 4 Region: 36-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000157
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_2BL_B304E8577.1
Sequence length 307
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_2BL_scaff_7958021:8522:11566:1 gene:Traes_2BL_B304E8577 transcript:Traes_2BL_B304E8577.1 description:""
Sequence
MDAAARKRSRPESANGGSAGGKRSRESESQQTGLSSKSKPCTKFFSTVGCPFGEGCHFAH
FVPGGYQAVSKSHSLGHAAVSAASRAPADHAASGVKTRMCTKYNTAEGCKFGDKCHFAHG
ERELGRPPSSYMSQESSYAPPMGGRYGGRHEPPPPASMGPPAGNFGASSTCKVSVDAALA
GGIIGKGGVNTKQICRITGVKLSIRDHESNPDLKNIELEGSFDQIKQANDMVRDLIASIS
ASTPSKNPAGTAAPAGRGGGGGGGGGPGGRSNYKTKICENFLKGTCTFGERCHFAHGETE
QRKGAAV
Download sequence
Identical sequences W5BE59
Traes_2BL_B304E8577.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]